SecReT6
Protein ID: 568310481
SecReT6 ID895
T6SS typei1
Gene symbol-
Locus tagSCV20265_3744
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3992241..3993572 [-]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDV9U4S8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.60E-144, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|568310481|ref|YP_008982750.1| Uncharacterized protein ImpJ/VasE [Pseudomonas aeruginosa SCV20265]
MNVHKIVWQEGMLLRPQHLQHNDRYYDNQMKARTQLLGSYNWGFLALELDRQFLNMGKLVISQASGVLPD
GSLFELGGNTEPLALDVPPNTSNVPIYLALPLVTGNHIEARRPEQAEVLARYTAYDLEVADSNAGEDSMV
QVSCARPDFRLLLGEQQSDQAYVKLKVAVVLDTTPDGVISLDPDFVPSYLHAHASAYLLSCLKEVISMLG
HRGDTIAERIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLGLEQVHPEQLYRVLLTMLGDLATFGSESK
RPRLDSRYQHSDQGASFRRLMEAIRQVLSMVLEQHAIELPLQARQYGILVSPLHDHKLLGSASFVLAASA
NCESEELRQRLPAHLKVGAVEHIRQLVNLHLPGIRVKPLPVAPRQIPFHSNKTYFILEPNAEDMAQLERS
GGFAFHVSGEFSELELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c3993572-3992241 Pseudomonas aeruginosa SCV20265, complete genome
ATGAACGTGCACAAGATCGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCACCTGCAACACAACGACC
GCTACTACGACAACCAGATGAAGGCCCGGACCCAGTTGCTGGGCAGCTACAACTGGGGCTTCCTCGCCCT
GGAGCTGGACCGCCAGTTCCTCAACATGGGCAAGCTGGTGATCAGCCAGGCCTCCGGCGTACTGCCCGAC
GGCAGTCTGTTCGAACTCGGCGGCAACACCGAGCCGCTCGCCCTCGACGTGCCGCCCAATACCTCGAACG
TGCCGATCTACTTGGCCCTGCCGCTGGTCACCGGCAACCACATCGAGGCGCGCCGGCCGGAGCAGGCCGA
GGTCCTGGCGCGCTATACCGCCTACGACCTGGAGGTGGCGGACTCCAACGCCGGCGAGGATTCCATGGTA
CAGGTCAGCTGCGCGCGGCCGGATTTTCGCCTGCTGCTCGGCGAGCAGCAGAGCGACCAGGCCTACGTCA
AACTGAAGGTGGCGGTGGTGCTGGATACCACGCCGGACGGGGTGATCAGCCTCGATCCCGACTTCGTGCC
GAGCTACCTCCACGCCCACGCATCCGCCTACCTGCTGTCCTGCCTGAAGGAAGTGATCAGCATGCTCGGC
CATCGCGGCGACACCATCGCCGAGCGTATCCGGTCCAATGGCAAGGTCGGCGGCGCGGAGGTCGGCGATT
TCATGATGCTGCAACTGATCAATCGCACCGAGTTGCTGCTGCGCCACTACCTGGGATTGGAGCAGGTGCA
TCCGGAGCAGTTGTACCGGGTGCTGCTGACCATGCTCGGCGACCTCGCCACCTTCGGCAGCGAGAGCAAA
CGTCCGCGCCTGGACAGCCGTTACCAGCACAGCGACCAGGGCGCCAGCTTCCGCAGGCTGATGGAGGCGA
TCCGCCAGGTCCTGTCGATGGTGCTCGAGCAGCATGCCATCGAACTGCCTCTCCAGGCCCGCCAGTACGG
CATCCTGGTCTCGCCCCTGCACGACCACAAGTTGCTCGGCAGCGCCTCGTTCGTGCTCGCCGCCAGTGCC
AATTGCGAGTCGGAGGAACTGCGCCAGCGGCTGCCCGCGCATCTCAAGGTGGGTGCGGTCGAGCACATTC
GCCAACTGGTCAACCTGCACCTGCCGGGGATCCGGGTCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
GTTCCACTCCAACAAGACCTATTTCATTCTCGAACCCAACGCCGAGGACATGGCCCAGCTGGAGCGCTCC
GGTGGTTTCGCGTTCCACGTATCCGGCGAGTTCTCCGAGCTTGAACTGAAATTCTGGGCCATCAGGAACT
GA