SecReT6
Protein ID: 568310482
SecReT6 ID895
T6SS typei1
Gene symbol-
Locus tagSCV20265_3745
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3993569..3994084 [-]
ProductType VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDV9U639
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-42, Aligned region: 22..157
Protein Sequence: 171 a.a.     [Download]
>gi|568310482|ref|YP_008982751.1| Type VI secretion lipoprotein/VasD [Pseudomonas aeruginosa SCV20265]
MIAMSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHP
VAFENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPV
TAKELTRVELKLGQKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c3994084-3993569 Pseudomonas aeruginosa SCV20265, complete genome
ATGATCGCCATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGC
TGGCCGGCTGTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGA
GCGGGTCAATCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAACACCCG
GTGGCGTTCGAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGG
TGACCAGCGAGGAGCTGGAGCTGCGGCCCGGCGAGCGGGTCGAACTCAAACTCAGCGTGGAGGAGGGGAG
CCGCTACGTGGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTC
ACGGCGAAAGAGCTGACCCGGGTAGAGCTGAAGCTGGGCCAGAAGGGCATCCTGAATGCCGGCGAATTGC
TCGGCAAGGCGGGTGACGCGCGATGA