SecReT6
Protein ID: 568310483
SecReT6 ID895
T6SS typei1
Gene symbol-
Locus tagSCV20265_3746
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3994081..3995274 [-]
ProductUncharacterized protein ImpI/VasC
NoteFha
UniProt IDV9U7D5
KEGG IDpaes:SCV20265_3746
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.90E-14, Aligned region: 30..96
Protein Sequence: 397 a.a.     [Download]
>gi|568310483|ref|YP_008982752.1| Uncharacterized protein ImpI/VasC [Pseudomonas aeruginosa SCV20265]
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGAFYLTDTSSNG
IRAGNGSRLPHGEPQRIEQDSVFLFGDFEIRARLLREPDELAMDVGRPQPAGSIIPDDAFLALDPLQALD
QDGADAYELDDLSAIAQPSHEAGARADYARIDMESLVVPELVPAPAAPQEPVESPPPERDEAFWQRFGQA
LGVDLEGLDGAAREALAIDAAGLLRQCIGGLQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAGEAL
GHLLRDGKPGQLSGEQAVARSFRDLQAHQVALLGASRAAVRATLEHFSPQQLALRFERDGRRPLLATSGS
RWRAYGRYHQSLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c3995274-3994081 Pseudomonas aeruginosa SCV20265, complete genome
ATGGAACTGGTATTGGAAATGCTCAGCGCCAAGCAATTCGTACCGACGGAGCTATGCAGCAAGACCTTCG
GCAGGAACGGCGGCCTCATCGGCCGCGGCGGTGAGTGCGATTGGGCGATTCCCGATCGCAAGCGGCACCT
GTCCAAGCAGCATGCGCGGGTCAGCTATCGCAACGGCGCGTTCTACCTGACCGACACCAGCAGCAACGGC
ATCCGCGCCGGCAACGGCAGCCGCCTGCCGCATGGCGAGCCGCAGCGCATCGAGCAGGACAGCGTCTTCC
TGTTCGGCGACTTCGAGATCCGCGCGCGGTTGCTGCGCGAGCCCGACGAGCTCGCCATGGACGTCGGGCG
GCCGCAGCCGGCGGGCAGCATCATTCCGGACGATGCCTTCCTGGCCCTCGATCCGTTGCAGGCGCTCGAC
CAGGACGGTGCCGATGCCTACGAACTCGACGACCTGAGCGCGATCGCCCAGCCCAGTCATGAGGCCGGGG
CGCGTGCGGACTACGCGCGGATCGACATGGAAAGCCTGGTCGTACCGGAGCTGGTGCCCGCCCCGGCGGC
TCCGCAGGAACCCGTGGAAAGTCCGCCTCCGGAACGCGACGAAGCCTTCTGGCAGCGTTTCGGCCAGGCG
CTCGGAGTGGACCTCGAAGGCCTCGACGGCGCTGCGCGCGAAGCGCTGGCGATCGACGCCGCCGGTTTGC
TGCGGCAGTGCATCGGCGGCTTGCAGCAGAGCCTGCGGACCCGCAGCGAACTGAAGAACGAACTGCGCCT
GTCGCTGAGCACATTGCGCGATACCGGCAAGAATCCCTTGCGCTTCAGCGCCGATGCCGGCGAGGCGCTG
GGTCATCTGCTACGGGATGGCAAGCCTGGCCAGTTGAGTGGCGAACAGGCCGTCGCACGCAGTTTCCGCG
ACCTCCAGGCGCACCAGGTGGCGCTGCTCGGCGCCAGCCGGGCGGCGGTGCGCGCGACCCTCGAGCATTT
CTCGCCGCAGCAGCTGGCCCTGCGTTTCGAGCGCGACGGTCGCCGGCCGTTGCTGGCCACCTCGGGCAGC
CGCTGGCGTGCCTATGGTCGCTACCACCAGTCGCTATGCCAGGACGACGATTGGAGCGAGCGTCTGTTGG
CGCGTGATTTCGCCCAGGCCTACGAAGAGCAGGTTCGCCTGATTTCCACCCTCTACACCGAGCACCAAGG
ATGA