SecReT6
Protein ID: 568310489
SecReT6 ID895
T6SS typei1
Gene symbol-
Locus tagSCV20265_3752
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]4002779..4003186 [-]
Producthypothetical protein
NoteTssE
UniProt IDV9U3R8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-18, Aligned region: 24..114
Protein Sequence: 135 a.a.     [Download]
>gi|568310489|ref|YP_008982758.1| Uncharacterized protein SCV20265_3752 [Pseudomonas aeruginosa SCV20265]
MTGYGSLFERLNGDADKRVGWSREVSAMASVAAHLGKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARSAIEGFIEAYEPRLSDVRVVSLPRDNDQLRLAFSIEGLLEVEGFKRQVSFSACLDGSGQVKVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c4003186-4002779 Pseudomonas aeruginosa SCV20265, complete genome
ATGACCGGATACGGCAGCCTGTTCGAGCGCCTGAACGGCGACGCGGATAAGCGCGTCGGCTGGAGCCGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGGCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACTCCCTGAGCCAG
GCCCGCTCGGCCATCGAAGGTTTCATCGAGGCTTACGAACCGCGCTTGAGCGACGTGCGTGTCGTTTCCC
TGCCACGCGACAACGACCAGCTCCGCCTGGCCTTCAGCATCGAAGGGTTGCTGGAGGTGGAAGGTTTCAA
GCGCCAGGTGAGTTTTTCCGCATGCCTGGATGGCAGCGGCCAGGTGAAGGTCAGCTAA