SecReT6
Protein ID: 58582657
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3034
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3258391..3259431 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ5GYD3
KEGG IDxoo:XOO3034
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.60E-20, Aligned region: 58..118
Protein Sequence: 346 a.a.     [Download]
>gi|58582657|ref|YP_201673.1| hypothetical protein XOO3034 [Xanthomonas oryzae pv. oryzae KACC 10331]
MSRAMQIDNAPLLRPVDEQVPSGPNLEYTPEFQSLEELARPRQERALGAGVLVPDAPQWRQVAESAEHLL
GRSKDLRLGILLSIARLHQDGLVGWSSGVGLLRQLLEQFWGDVHPHLDADEDNDPTERVNAIAALADSER
TLTQLRNVRLFKGLHPGHFSLRDLRIVQGTLKLAAEDASEIPDPAAIDACLRDCPLEALLDLDAALAAAQ
DDIAAIAGVFAERTPGHGPELAPLTQDLDELRAFLRPYVSERSGSPAEPTEHAAPGADTVRTSTPRAHAV
EHPDEVRRMLDQLCDYYARREPSSPVPLLLRRAQRLVGLDFTALIRDLAPRAIEELQVVSGQDHSD
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3258391-3259431 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGAGCCGCGCCATGCAGATCGACAACGCACCGTTGCTGCGACCGGTCGACGAACAGGTGCCATCCGGTC
CGAACCTGGAATACACCCCGGAGTTCCAGAGCCTGGAGGAACTTGCACGACCGCGTCAGGAGCGCGCCTT
GGGCGCTGGCGTGCTTGTGCCCGACGCGCCGCAATGGCGCCAGGTCGCCGAGAGCGCCGAACACTTGCTA
GGGCGCTCCAAGGACTTGCGGCTGGGCATCTTGCTGAGCATCGCCCGCTTGCACCAGGACGGTCTGGTGG
GCTGGTCCAGCGGCGTCGGCCTGCTCCGACAACTGCTGGAGCAGTTCTGGGGCGACGTCCATCCTCATCT
GGATGCCGATGAAGACAACGACCCGACCGAACGCGTCAACGCCATCGCTGCGTTGGCCGACAGCGAGCGC
ACGCTGACACAGCTGCGCAACGTGCGCCTATTCAAGGGACTGCATCCAGGACATTTCTCGCTGCGCGATC
TGCGCATCGTGCAAGGCACGCTCAAGCTCGCTGCGGAGGACGCGAGCGAGATACCAGATCCTGCCGCCAT
CGATGCCTGCCTGCGCGACTGCCCGCTGGAGGCGTTGCTTGATCTGGACGCAGCCCTGGCCGCTGCGCAG
GACGACATTGCCGCAATTGCCGGCGTGTTCGCCGAGCGCACTCCGGGGCACGGTCCGGAGCTGGCACCGC
TCACGCAGGATCTGGACGAGTTGCGTGCGTTCCTGCGGCCCTATGTGTCCGAACGTTCCGGATCCCCGGC
CGAGCCGACCGAACATGCAGCACCGGGCGCCGACACTGTCAGGACATCGACGCCACGCGCGCACGCCGTG
GAGCATCCGGACGAGGTTCGCCGCATGCTCGACCAGCTCTGCGATTACTACGCGCGGCGCGAGCCCTCCA
GCCCGGTGCCGTTACTGTTGCGGCGCGCACAACGCCTGGTCGGCCTGGATTTCACCGCACTGATACGCGA
TCTCGCGCCGCGCGCGATTGAAGAGCTGCAAGTGGTGTCGGGCCAGGACCATTCCGACTAG