SecReT6
Protein ID: 58582662
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3039
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3267652..3268968 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ5GYC8
KEGG IDxoo:XOO3039
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-65, Aligned region: 57..262
OmpA [PF00691], Evalue: 2.80E-15, Aligned region: 201..234
OmpA [PF00691], Evalue: 2.80E-15, Aligned region: 329..419
Protein Sequence: 438 a.a.     [Download]
>gi|58582662|ref|YP_201678.1| hypothetical protein XOO3039 [Xanthomonas oryzae pv. oryzae KACC 10331]
MSNTVDQHDDDATVVRSATPAPRPAASMPPRQSPTRTRRPPDLDAAMRATPGAMQGNAVVRAATPLLLLA
VQLRHSAQTPEIATLRENCGTRLQRFEQELRQQGTDDKTGIAARYVLCTLLDEAVLAAPWGEASGWSQRT
LLVTFHGETYGGAKVFDLLDRLARDPARHLDLLELLYLALALGFGGRYRVEQGGGARLADRQAELYQLIQ
RQRVPAPAELSPHWQGAQAPLLRNAAATPLWIAALASLCIVLLAFVWLHARLNTLTAPISAQLARIGLER
VALPIPAAVRAATIPALAPLLAAEQRAGLLTVHTDGDGRSTVRLASASMFPSGSAELDADQTHLLERVAA
ALEQVPGRVVVVGHTDDQPVRSLRFKDNFALSARRAESVGAVLAAGLRDRRRVQTSGAGDSQPIALPPQL
PGNRARNRRVEILLIPET
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3268968-3267652 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGAGCAACACGGTCGACCAGCACGACGACGATGCCACCGTGGTCCGCAGCGCGACGCCGGCGCCGCGGC
CCGCCGCATCCATGCCGCCCCGCCAATCACCGACGCGGACGAGGCGACCGCCCGATCTGGATGCCGCCAT
GCGCGCGACGCCAGGTGCGATGCAGGGCAATGCGGTGGTGCGCGCAGCCACGCCGCTGCTGCTGCTGGCG
GTGCAGTTGCGACACTCCGCGCAGACGCCGGAGATCGCCACCTTGCGCGAGAACTGCGGCACGCGCCTGC
AGCGCTTCGAGCAGGAGCTGCGGCAACAGGGCACCGACGACAAGACCGGCATCGCCGCGCGCTACGTGCT
GTGCACGTTGCTCGACGAAGCGGTGCTGGCCGCGCCCTGGGGCGAGGCCAGCGGCTGGTCGCAGCGCACT
TTGCTGGTGACGTTCCACGGCGAAACCTATGGCGGCGCCAAGGTCTTCGACCTGCTCGATCGGCTGGCAC
GCGATCCGGCGCGGCACCTGGACCTGCTGGAGCTGCTGTACCTGGCATTGGCGCTGGGCTTTGGTGGCCG
CTATCGGGTGGAGCAGGGTGGCGGGGCACGGCTGGCCGATCGCCAGGCCGAGCTCTACCAACTCATCCAG
CGTCAGCGCGTGCCTGCGCCTGCCGAGTTGTCGCCGCATTGGCAAGGCGCGCAGGCGCCGTTGCTGCGCA
ATGCAGCGGCCACGCCGCTGTGGATCGCGGCGCTGGCCTCGCTGTGCATCGTGTTGCTGGCGTTCGTGTG
GTTGCATGCGCGCCTCAATACGCTGACCGCGCCGATCAGCGCGCAGCTGGCGCGCATCGGCCTGGAGCGG
GTGGCGTTGCCGATCCCGGCGGCAGTCAGAGCGGCGACCATACCGGCGCTTGCACCGCTGCTGGCGGCCG
AGCAACGCGCAGGGTTGCTGACCGTCCACACCGACGGCGATGGCCGCAGCACCGTGCGCCTGGCCAGCGC
ATCCATGTTCCCCAGCGGCAGCGCGGAGTTGGATGCCGATCAGACCCACCTGCTCGAACGCGTTGCTGCG
GCGCTTGAACAGGTGCCGGGGCGGGTGGTGGTGGTGGGGCATACCGACGATCAGCCGGTGCGCTCGCTGC
GCTTCAAGGACAACTTCGCCTTATCCGCACGTCGCGCCGAGAGCGTGGGCGCCGTGTTGGCGGCAGGCCT
GCGCGATCGACGCCGGGTACAGACCAGTGGCGCGGGCGATTCCCAGCCCATCGCGCTACCGCCGCAATTG
CCCGGCAACCGTGCGCGCAATCGGCGCGTCGAGATCCTGTTGATTCCCGAGACCTGA