SecReT6
Protein ID: 58582666
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3043
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3272286..3274334 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ5GYC4
KEGG IDxoo:XOO3043
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.10E-73, Aligned region: 60..365
Phage_base_V [PF04717], Evalue: 2.90E-21, Aligned region: 407..500
Protein Sequence: 682 a.a.     [Download]
>gi|58582666|ref|YP_201682.1| hypothetical protein XOO3043 [Xanthomonas oryzae pv. oryzae KACC 10331]
MWHRDYRFPCTPARPAKSSHAIDLCAYVPQDHSGSLTMAHAITLQSPLGKTLRFVRMSAHEALGRPYAFA
LHGISRDVAIDLRALLGKPMAVKVTSPQGYVRHYHGIVAEAEQTGFEQIEGLRYATYAFSLVPKLWLLGQ
RRDCRIYKNKSVPELVRALLAEVGCTDVKLRLSASYTPREYCVQYRESALDFISRLMEQEGIYYYFAHSA
STHTLVLADSLGAHESSAPFAQIPYCPPGQKGSRMKDAITDWSLARSAHSTRVRLDDYDYLKPKASLRVD
ETPAESSGPALGELDVFDYPGEHLDVAAGRRHAQVRAEALNVAQAQYQGWTDACGLQVGALFKLRDFPLA
EHNQEYLVTSADTELVEVDYVSGGQTVAEPFASTFRALRSRQPFRTPQTTPRPSIAGVQTALVDGNKAED
IAVDQYGRVQVNFFWSPPGTPNAVCSCPVRVAQSWAGKRWGAQHIPRVGQEVVVSFLEGNPDRPLIIGSV
YNADQLPPYALPEHRTRSGVKSRSLSGGAEDYNEIRFDDKKGNEELLLHAQRDLRHEAENDHFVTVDRNE
TAEIKRERSHTVGGNDRLDVGKTLRIQAGSEIALVTGMARLQLKASGEIVLSGTRLTLDGRVSVGIQGGV
SVDVSAMANLTLRSNASVLLQSNAVTTARANAALLLQSSGPAVLKGTPPIIA
 
Nucleotide Sequence: 2049 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3274334-3272286 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGTGGCATCGCGATTATCGATTTCCCTGCACCCCGGCGCGGCCGGCAAAGTCATCGCATGCCATCGACC
TTTGCGCCTATGTACCGCAAGACCACTCCGGGAGCCTGACCATGGCCCACGCCATTACCCTGCAGTCGCC
GCTTGGCAAGACGCTGCGCTTTGTGCGGATGAGCGCGCACGAGGCACTGGGGCGGCCCTATGCGTTCGCG
TTGCACGGCATCAGCCGCGATGTGGCGATCGACCTGCGCGCTCTGCTGGGCAAGCCGATGGCGGTCAAGG
TCACTTCACCGCAGGGCTATGTGCGGCATTACCACGGCATCGTCGCCGAGGCGGAGCAGACCGGGTTCGA
GCAGATCGAGGGGCTGCGCTACGCCACCTATGCCTTCTCGCTGGTGCCCAAGCTGTGGTTGCTCGGGCAG
CGCCGCGATTGCCGCATCTACAAGAACAAGAGCGTGCCGGAGCTGGTGCGCGCGTTGCTGGCCGAGGTTG
GATGCACCGACGTGAAGCTGCGCCTGAGCGCGAGCTACACGCCGCGCGAATACTGCGTGCAGTACCGCGA
GAGCGCGCTGGACTTCATCAGCCGCTTGATGGAGCAAGAGGGCATCTACTACTACTTCGCACACAGTGCC
AGCACGCATACGCTGGTGCTGGCCGACAGTCTCGGCGCGCACGAATCCTCTGCGCCATTCGCACAAATCC
CTTACTGCCCGCCCGGGCAGAAGGGCAGCCGGATGAAGGACGCGATCACCGATTGGTCGCTGGCGCGCAG
CGCGCACAGCACGCGCGTGCGCCTGGACGACTACGACTATCTCAAGCCCAAGGCCTCGCTGCGGGTGGAC
GAGACACCGGCCGAGTCTTCGGGACCGGCGCTGGGCGAGCTGGATGTGTTCGATTATCCCGGCGAGCATC
TCGATGTCGCGGCCGGTCGTCGTCACGCGCAGGTGCGTGCCGAAGCGCTCAACGTGGCGCAGGCGCAATA
CCAGGGCTGGACCGATGCCTGCGGTTTGCAGGTGGGCGCATTGTTCAAGCTGCGCGACTTTCCGCTGGCC
GAGCACAACCAGGAATACCTGGTGACCAGCGCGGACACCGAACTGGTTGAAGTGGATTATGTGTCCGGTG
GCCAGACGGTTGCCGAGCCGTTTGCGTCCACCTTCCGTGCGCTACGCAGTCGGCAGCCGTTTCGGACCCC
GCAGACCACGCCGCGTCCGAGTATTGCCGGGGTGCAGACCGCGCTCGTCGACGGCAACAAGGCCGAGGAT
ATTGCGGTCGATCAGTACGGCCGTGTGCAGGTGAATTTCTTCTGGAGTCCGCCGGGAACGCCAAACGCCG
TCTGCTCGTGCCCGGTACGCGTGGCGCAGTCGTGGGCGGGCAAACGCTGGGGCGCGCAGCACATTCCGCG
TGTGGGCCAGGAGGTGGTGGTGAGCTTTCTGGAAGGCAATCCGGATCGTCCGCTGATCATCGGCAGCGTC
TACAACGCCGACCAGCTGCCACCGTATGCACTGCCCGAGCACCGCACCCGTAGCGGGGTAAAGAGCCGCA
GCCTGTCGGGTGGGGCAGAGGACTACAACGAGATCCGTTTCGACGACAAGAAGGGCAACGAAGAGCTGCT
GCTGCATGCGCAGCGCGATCTGCGCCACGAAGCGGAGAACGACCATTTCGTCACTGTCGACCGCAACGAA
ACCGCCGAGATCAAACGCGAACGCAGCCACACCGTTGGCGGCAACGACCGTCTGGACGTGGGCAAGACAC
TCCGCATCCAGGCAGGGAGCGAGATCGCGTTGGTGACCGGGATGGCTCGCCTGCAGTTGAAGGCCAGCGG
CGAGATCGTGCTCAGCGGCACCCGGCTCACGCTCGATGGACGCGTCAGCGTCGGCATCCAGGGTGGCGTC
AGTGTCGATGTCAGCGCGATGGCCAACCTGACCCTGCGCTCGAACGCGTCGGTGCTGCTGCAATCCAACG
CCGTGACCACCGCGCGCGCCAACGCGGCGCTGCTGTTGCAGTCGTCAGGTCCGGCCGTGCTCAAGGGCAC
TCCGCCCATCATCGCTTGA