SecReT6
Protein ID: 58582668
SecReT6 ID82
T6SS typei3
Gene symbolclpB
Locus tagXOO3045
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3276579..3279377 [-]
Productchaperone ClpB
NoteTssH
UniProt IDQ5GYC2
KEGG IDxoo:XOO3045
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.10E-40, Aligned region: 256..275
AAA_2 [PF07724], Evalue: 4.10E-40, Aligned region: 664..830
AAA [PF00004], Evalue: 3.10E-17, Aligned region: 256..368
AAA [PF00004], Evalue: 3.10E-17, Aligned region: 670..754
ClpB_D2-small [PF10431], Evalue: 1.10E-14, Aligned region: 837..912
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 157..197
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 233..279
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 300..334
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 640..712
AAA_16 [PF13191], Evalue: 2.20E-12, Aligned region: 734..756
AAA_5 [PF07728], Evalue: 5.90E-12, Aligned region: 256..276
AAA_5 [PF07728], Evalue: 5.90E-12, Aligned region: 669..787
Sigma54_activat [PF00158], Evalue: 4.40E-07, Aligned region: 234..278
Sigma54_activat [PF00158], Evalue: 4.40E-07, Aligned region: 668..782
Zeta_toxin [PF06414], Evalue: 9.80E-06, Aligned region: 255..278
Zeta_toxin [PF06414], Evalue: 9.80E-06, Aligned region: 668..709
Zeta_toxin [PF06414], Evalue: 9.80E-06, Aligned region: 842..874
AAA_22 [PF13401], Evalue: 1.00E-05, Aligned region: 255..280
AAA_22 [PF13401], Evalue: 1.00E-05, Aligned region: 387..422
AAA_22 [PF13401], Evalue: 1.00E-05, Aligned region: 667..692
AAA_22 [PF13401], Evalue: 1.00E-05, Aligned region: 731..753
NACHT [PF05729], Evalue: 5.90E-05, Aligned region: 256..284
NACHT [PF05729], Evalue: 5.90E-05, Aligned region: 669..696
AAA_14 [PF13173], Evalue: 5.90E-05, Aligned region: 256..324
AAA_14 [PF13173], Evalue: 5.90E-05, Aligned region: 362..422
AAA_14 [PF13173], Evalue: 5.90E-05, Aligned region: 668..779
AAA_17 [PF13207], Evalue: 8.00E-05, Aligned region: 256..280
AAA_17 [PF13207], Evalue: 8.00E-05, Aligned region: 531..577
AAA_17 [PF13207], Evalue: 8.00E-05, Aligned region: 669..707
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 251..332
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 382..422
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 667..694
Arch_ATPase [PF01637], Evalue: 0.00062, Aligned region: 234..276
Arch_ATPase [PF01637], Evalue: 0.00062, Aligned region: 669..711
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 249..278
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 669..688
AAA_18 [PF13238], Evalue: 0.0024, Aligned region: 256..276
AAA_18 [PF13238], Evalue: 0.0024, Aligned region: 670..700
AAA_29 [PF13555], Evalue: 0.0062, Aligned region: 248..271
AAA_29 [PF13555], Evalue: 0.0062, Aligned region: 667..694
DUF815 [PF05673], Evalue: 0.0074, Aligned region: 246..331
DUF815 [PF05673], Evalue: 0.0074, Aligned region: 668..707
Protein Sequence: 932 a.a.     [Download]
>gi|58582668|ref|YP_201684.1| chaperone ClpB [Xanthomonas oryzae pv. oryzae KACC 10331]
MARPLSPHARCRPARAYVALMRFSVFTSGVFMADISRAALFGKLNKTTYRGIESATAFCRLRGDHEVELL
HWLHQLLQAQDGDLHRIVRRFSLDASRLAQDLTVALDRLPRGGGGHFDLSASVEEAVERAWVHCTLRYGR
QRIRGGDLLVAILHTRSLRHGLLAMSSEFAKLRAEALADDLDDIVAGSPEDDATDVAAAVAPVGTGATGG
TAALALYTVDLTAQAREGKLDPIIGRDDEIRQVVDILMRRRQNNPILVGEAGVGKTAVVEGFAQRIARGD
VPPALQDVQLRTLDVGLLQAGASMKGEFEQRLRAVIDEVQASPKPIILFVDETHTLVGAGGAAGTGDAAN
LLKPALARGTLRTVGATTFAEYKKYIEKDPALTRRFQAVQVDEPDEAKAVRMMRGVASTMEQHHRVQILD
EALEAAVKLSHRYIPARQLPDKSVSLLDTACARVAVSLHATPAEVDDSRRRIESLDTEHAIIERERAIGI
VVDERAAACASLLQSEHGRLRELEQRWVAEKALVDALLSLRAQLRGGNAPVEGTGSALETEAEQRASGDI
AVLETPVHVDRDALLARLQLVQAELAALQGESPLILPTVDYQAVAAVVADWTGIPVGRMARNEIDTVLRL
PELLAKRVIGQDHAMEMIAKRIQTSRAGLDNPDKPIGVFLLAGTSGVGKTETALALAETLYGGEQNLITI
NMSEYQEAHTVSSLKGAPPGYVGYGEGGVLTEAVRRKPYAVVLLDEVEKAHPDVHELFFQVFDKGWMEDG
EGRRIDFRNTLIILTSNAGTDLIASLCKDPELMPDPDGMAKALREPLLKVFPPALLGRLVAIPYYPLSNA
MLGQIVRLQLNRIKQRIEERYRIPFDYDESVVELVVSRCTESESGGRMIDAILTNSMLPEISRKFLRGVV
DRKRTERLDIRVEDSALVYSFL
 
Nucleotide Sequence: 2799 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3279377-3276579 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGGCTCGGCCACTATCGCCGCACGCTCGATGCCGACCAGCTCGTGCTTACGTCGCCCTGATGCGTTTCT
CGGTTTTCACTTCTGGAGTTTTTATGGCAGACATCAGTCGCGCCGCCTTGTTCGGCAAGCTCAACAAGAC
CACCTATCGCGGTATCGAATCGGCCACTGCGTTCTGCAGGCTACGTGGCGACCACGAAGTGGAACTGCTG
CACTGGCTGCATCAGTTGCTGCAGGCGCAAGACGGCGACTTGCACCGCATCGTGCGCCGTTTTTCGCTGG
ATGCGTCGCGGCTTGCACAGGACCTGACCGTGGCGCTCGATCGCCTGCCGCGCGGCGGTGGCGGACACTT
CGATCTGTCGGCCAGCGTGGAGGAGGCAGTGGAACGCGCCTGGGTGCACTGCACGTTGCGTTACGGGCGG
CAACGCATCCGTGGCGGCGATCTGCTGGTGGCGATCCTGCACACGCGTAGCCTGCGTCACGGGTTGCTGG
CGATGTCGAGCGAGTTCGCCAAGCTGCGCGCGGAAGCACTGGCGGACGATCTGGATGACATCGTCGCCGG
CTCGCCGGAAGACGATGCCACCGACGTTGCGGCGGCTGTCGCCCCCGTTGGGACTGGCGCAACAGGTGGT
ACTGCGGCGCTCGCGCTGTACACGGTCGACCTCACCGCACAAGCGCGCGAGGGCAAGCTGGACCCGATCA
TCGGCCGCGACGACGAGATTCGCCAGGTCGTCGATATCCTGATGCGGCGCCGCCAGAACAACCCGATCCT
GGTTGGCGAGGCCGGCGTCGGCAAGACCGCGGTGGTGGAAGGCTTCGCACAACGTATCGCGCGCGGCGAT
GTGCCGCCCGCGTTGCAGGATGTGCAGCTGCGCACGCTCGATGTCGGCTTGCTGCAAGCCGGCGCCAGCA
TGAAAGGTGAGTTCGAGCAGCGCTTGCGCGCAGTCATCGACGAAGTGCAGGCCAGCCCCAAGCCGATCAT
TCTGTTCGTGGATGAAACCCATACCCTGGTCGGCGCCGGTGGCGCGGCCGGCACCGGCGATGCGGCCAAC
CTGCTCAAGCCGGCACTGGCGCGCGGCACCTTGCGCACCGTAGGCGCGACCACCTTTGCCGAGTACAAAA
AGTACATCGAAAAAGACCCTGCATTGACGCGGCGCTTCCAGGCCGTGCAGGTCGACGAGCCGGACGAGGC
CAAGGCCGTGCGGATGATGCGCGGTGTCGCCTCGACGATGGAACAGCACCACCGCGTGCAGATCCTTGAC
GAAGCGCTGGAAGCGGCGGTCAAGCTCAGTCACCGCTACATCCCGGCGCGCCAGCTGCCAGACAAATCGG
TCAGTCTGCTCGATACCGCCTGCGCGCGCGTCGCGGTGAGCCTGCATGCCACGCCTGCGGAAGTGGACGA
CAGCCGTCGCCGCATCGAATCGCTGGACACCGAGCACGCCATCATCGAGCGCGAGCGTGCGATTGGCATC
GTGGTCGATGAGCGTGCTGCCGCTTGCGCCAGCCTGCTGCAAAGCGAGCACGGCCGCCTGCGCGAGCTGG
AACAGCGCTGGGTTGCCGAAAAGGCGTTGGTCGATGCGCTGTTGTCGCTACGCGCGCAACTGCGAGGCGG
CAACGCGCCGGTGGAAGGGACCGGCAGTGCGTTGGAAACGGAGGCCGAACAGCGTGCGTCTGGCGATATC
GCGGTGCTCGAAACGCCGGTACACGTGGATCGCGATGCGCTCTTAGCACGTTTGCAGTTGGTACAGGCCG
AACTGGCCGCATTGCAGGGCGAATCGCCGCTGATCCTGCCCACAGTCGATTACCAAGCCGTGGCCGCGGT
GGTCGCCGACTGGACCGGCATCCCTGTCGGGCGCATGGCCCGCAACGAGATCGACACCGTGCTGCGCTTG
CCCGAACTGCTGGCCAAGCGCGTGATCGGCCAGGACCACGCCATGGAGATGATCGCCAAGCGGATCCAGA
CCAGCCGCGCCGGCCTGGACAACCCGGACAAACCGATCGGCGTGTTCCTGCTGGCCGGAACCTCCGGCGT
CGGCAAGACCGAAACCGCACTCGCCCTGGCCGAAACGCTGTACGGCGGCGAGCAAAACCTGATCACCATC
AACATGAGCGAGTACCAAGAGGCGCACACTGTCTCCTCGCTCAAGGGCGCACCGCCGGGCTATGTGGGCT
ACGGCGAAGGTGGCGTACTGACCGAAGCGGTGCGCCGCAAGCCGTACGCGGTCGTGCTGCTGGACGAAGT
GGAAAAAGCCCACCCGGACGTGCACGAACTGTTCTTCCAGGTCTTCGACAAGGGCTGGATGGAAGACGGC
GAAGGCCGCCGCATCGACTTCCGCAACACCTTGATCATCCTTACCAGCAACGCCGGCACCGACCTGATCG
CCAGCCTGTGCAAGGACCCGGAATTGATGCCGGATCCGGACGGCATGGCCAAGGCATTGCGCGAACCGTT
GTTGAAGGTGTTTCCGCCGGCATTGCTCGGGCGGCTGGTGGCGATTCCGTATTACCCGCTCAGTAACGCC
ATGCTCGGACAGATCGTGCGATTGCAGTTGAACCGCATCAAGCAGCGGATCGAAGAGCGCTACAGGATTC
CGTTCGACTACGACGAGTCTGTAGTGGAGCTGGTGGTGAGCCGGTGTACCGAGAGCGAATCGGGTGGCCG
GATGATCGATGCGATTTTGACTAACTCGATGTTGCCGGAGATTAGCCGCAAATTTCTTCGTGGGGTAGTG
GACCGGAAACGGACTGAACGCCTTGACATTCGTGTCGAAGATTCCGCATTGGTTTATTCGTTTCTCTGA