SecReT6
Protein ID: 58582669
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3046
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3279317..3280357 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ5GYC1
KEGG IDxoo:XOO3046
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.00E-110, Aligned region: 30..331
Protein Sequence: 346 a.a.     [Download]
>gi|58582669|ref|YP_201685.1| hypothetical protein XOO3046 [Xanthomonas oryzae pv. oryzae KACC 10331]
MHARTQRGRSMASPSRQSADPVALFARLDAQPQAFELFEALRWLECAHPAQPRLGQAARPLEEPVRLGQR
ASLEFPPRDIDSVHAGVDGRPPTLRTLSLGLFGPHGALPLHLTEHAIERESAGDPTFAAFADMFHHRMIA
LWYRAWADARPTVQMDRVGDDRFGARLDALTGVDQPALRDRDAMPVAARRHFAGRFIAQARNAEGLRAVL
TGLFDVPVQVQEFVANWLTLPEEGRLRMGRAAARIGRDATLGASARNAQHRFRLRIGPLEIARYREFLPG
GQALDVLTAAVRGYIGDEQAWDLQLVLAREDVPLPVLGQGQRIGLSLWLGHYRRTLDADQLVLTSP
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3280357-3279317 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGCACGCCCGAACGCAACGAGGTCGCTCGATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAGCGC
TGTTCGCGCGGCTGGATGCGCAACCGCAGGCCTTCGAGCTATTCGAAGCGCTGCGGTGGCTGGAGTGCGC
GCATCCGGCGCAACCGCGTCTGGGCCAGGCAGCACGGCCGTTGGAAGAGCCTGTGCGTTTGGGCCAGCGC
GCCTCGCTGGAATTTCCTCCGCGCGACATCGACAGCGTGCACGCTGGCGTTGACGGTCGCCCGCCGACCC
TGCGCACGCTGTCGCTGGGCTTGTTCGGCCCGCATGGTGCGCTGCCGTTGCACCTGACCGAGCACGCCAT
CGAACGTGAAAGCGCTGGCGATCCCACCTTTGCGGCCTTTGCCGACATGTTTCACCATCGCATGATTGCG
CTGTGGTATCGCGCCTGGGCCGATGCGCGACCCACCGTGCAGATGGATCGCGTGGGCGATGACCGCTTCG
GCGCGCGGCTGGATGCGTTAACCGGTGTGGACCAACCTGCGTTACGTGATCGCGATGCGATGCCGGTGGC
TGCACGCCGGCACTTCGCCGGTCGCTTCATTGCCCAGGCGCGCAATGCGGAAGGCTTGCGTGCTGTGCTG
ACCGGCCTGTTCGACGTCCCGGTGCAGGTGCAGGAATTCGTTGCCAACTGGTTGACGCTGCCCGAGGAAG
GGCGACTGCGGATGGGACGTGCTGCTGCGCGTATCGGGCGTGACGCCACGCTTGGCGCATCGGCGCGCAA
CGCGCAGCATCGCTTCCGCCTGCGGATCGGCCCCTTGGAGATCGCCCGCTACCGCGAGTTCCTGCCGGGC
GGCCAGGCCCTGGACGTACTGACCGCCGCAGTACGCGGCTACATCGGCGACGAGCAGGCCTGGGACTTAC
AACTCGTGCTGGCGCGCGAAGACGTCCCGTTGCCAGTCCTGGGGCAGGGCCAGCGCATCGGCCTGTCGCT
GTGGCTCGGCCACTATCGCCGCACGCTCGATGCCGACCAGCTCGTGCTTACGTCGCCCTGA