SecReT6
Protein ID: 58582670
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3047
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3280291..3282168 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ5GYC0
KEGG IDxoo:XOO3047
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.20E-214, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|58582670|ref|YP_201686.1| hypothetical protein XOO3047 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDPRLLHHYNRELQHVREMGAEFAQAYPKVAGRLGMSGIECADPYVERLLEGFAFLSARVQVELEAQQPA
FAQHLTEMLYPHFLSPVPSMAVVELQPEQGEGIGPAGHVVPRGSALRSLIGHGDRTACEYRTAHAVTLLP
LRLTAASYLTSPAALATLGVPVEPRARAGLRLVFNVDPGLRLDMLALDTLPIFITGADGLAGTLHEQLHA
NALGFVVRARSADGQVLTRTFGPEHLQPQGFDDEQALLPRSERSFSGYRLLQEYFACPERFLFTAFDGLA
QVLTRAACAEFEMLVWFDRSVERLDNAVDASNFRLHCTPAINLFPRRGDRIHLHPGISEHHVLADRTRPM
DFEIHGVEQVEGFGDGNAPMQRFEPFYGAQPRSWHERRSAFYALRRQPRRLSTGQRRTGPRSSYVGSEVF
LSLVDGDQAPYSHQLRQLGMQLWCSNRDLPLHMPVGKSSTDFVLDDGGPVASIRCVAGPTRPRSGVTAGD
TRWRLISHLQLNYLSLLDAGDDGATALREMLTLYHDPHDAAARRQVDGVRRIASRPIVRRIPVPGPATYG
RGLEITLTCDDAAFEGQGVYLLASVLRHVFARQASLNSFTETVLCTPERNEVARWPAHLGNRPIL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3282168-3280291 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGATCCGCGCCTGCTCCATCACTACAACCGCGAGTTGCAGCATGTGCGCGAGATGGGTGCGGAATTCG
CGCAGGCGTATCCGAAAGTGGCGGGCCGGCTTGGGATGAGCGGTATCGAGTGCGCCGACCCGTATGTCGA
ACGTCTGCTGGAAGGGTTTGCCTTCCTGTCTGCGCGCGTGCAGGTCGAACTCGAAGCCCAGCAGCCTGCA
TTCGCGCAGCATCTGACGGAAATGCTGTATCCACATTTCCTGTCGCCGGTGCCGTCGATGGCCGTGGTGG
AGCTGCAACCGGAGCAAGGCGAGGGCATCGGCCCAGCGGGGCATGTGGTGCCGCGCGGCAGCGCGTTGCG
CTCGTTGATCGGGCATGGCGACCGCACCGCCTGCGAATATCGCACCGCGCACGCGGTGACGCTGTTGCCG
CTGCGCCTGACTGCCGCCAGTTATCTCACCTCGCCGGCAGCGCTGGCCACGCTCGGTGTGCCGGTCGAGC
CGCGTGCGCGCGCCGGCCTTCGCCTGGTCTTCAACGTCGACCCCGGGCTGCGCCTGGACATGCTGGCGCT
GGACACATTGCCGATCTTCATCACCGGCGCCGATGGGTTGGCCGGCACCCTCCACGAACAACTGCATGCC
AATGCGTTGGGATTTGTGGTGCGTGCCCGCTCCGCGGATGGGCAGGTGCTGACGCGCACCTTCGGTCCCG
AGCATCTGCAGCCGCAGGGCTTCGATGACGAGCAGGCGCTGCTGCCGCGCAGCGAACGCTCTTTCAGCGG
CTATCGCCTGCTGCAGGAATATTTTGCCTGCCCCGAGCGTTTCCTGTTTACCGCCTTCGATGGCCTGGCG
CAGGTGCTGACGCGAGCGGCGTGCGCCGAATTCGAGATGTTGGTGTGGTTCGACCGCAGCGTCGAGCGGC
TCGATAACGCGGTGGACGCAAGTAACTTCCGCCTGCATTGCACCCCGGCGATCAACCTGTTTCCTCGGCG
CGGTGATCGTATCCATCTGCATCCCGGCATCTCCGAGCACCACGTGTTGGCTGACCGCACGCGGCCGATG
GACTTCGAGATTCATGGCGTGGAGCAGGTCGAAGGCTTCGGCGATGGCAATGCGCCAATGCAGCGTTTCG
AGCCGTTCTATGGCGCGCAGCCGCGCAGTTGGCATGAGCGGCGTTCGGCATTTTATGCCTTGCGACGGCA
GCCGCGGCGGCTGTCGACGGGACAGCGTCGTACCGGGCCGCGCTCGAGCTACGTTGGCAGCGAGGTGTTC
CTGTCGTTGGTCGATGGCGACCAGGCGCCGTATTCGCACCAACTGCGGCAACTGGGCATGCAGCTGTGGT
GCAGCAACCGCGATCTGCCGCTGCATATGCCGGTGGGCAAATCCAGCACCGACTTCGTCCTCGACGATGG
CGGCCCGGTGGCGTCGATCCGCTGCGTTGCAGGTCCAACGCGACCGCGCTCGGGCGTGACCGCCGGCGAT
ACCCGCTGGCGCCTGATCAGCCATCTGCAGTTGAACTATCTCTCGCTGCTGGATGCCGGCGACGACGGTG
CCACCGCATTGCGCGAGATGCTCACGCTGTACCACGACCCGCACGATGCCGCTGCGCGACGACAGGTAGA
CGGCGTGCGCCGCATCGCTTCGCGCCCGATCGTAAGGCGCATTCCGGTGCCGGGCCCGGCCACCTATGGC
CGCGGACTTGAGATCACCTTGACCTGCGACGACGCGGCCTTTGAAGGGCAGGGCGTCTATCTGCTTGCCT
CGGTGCTGCGGCATGTCTTTGCGCGCCAGGCATCGCTCAATTCCTTTACCGAAACCGTGCTATGCACGCC
CGAACGCAACGAGGTCGCTCGATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAG