SecReT6
Protein ID: 58582671
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3048
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3282172..3282675 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ5GYB9
KEGG IDxoo:XOO3048
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-20, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|58582671|ref|YP_201687.1| hypothetical protein XOO3048 [Xanthomonas oryzae pv. oryzae KACC 10331]
MAELTQQERLQPSLLDRLIDDRRHEPAESRDARAISPAKLRDCVMRDLAWLLNCTRHWHEDALQAYPHVA
SSVLNYGIPDLAGARLAGLDVIALQNRIREAIVAFEPRLAAASLQVTAKVDIGRMDRMSLSFVIDSELWA
QPLPLALYLRTDLDLETGRFSLSSAGH
 
Nucleotide Sequence: 504 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3282675-3282172 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGCCGAACTGACCCAACAAGAGCGTTTGCAGCCATCGCTGCTGGACCGATTGATCGACGACCGCCGAC
ACGAACCGGCGGAAAGCCGCGACGCGCGGGCGATCAGTCCAGCCAAGCTGCGCGACTGCGTCATGCGCGA
CCTGGCCTGGCTGCTCAATTGCACGCGCCACTGGCATGAGGATGCGTTGCAGGCGTATCCGCACGTCGCC
AGCTCGGTACTCAATTACGGCATTCCCGACCTGGCCGGCGCACGGCTGGCGGGGCTGGACGTGATCGCAC
TGCAGAACCGCATTCGTGAGGCGATTGTGGCGTTCGAGCCGCGCCTGGCTGCGGCCAGCCTGCAGGTCAC
CGCGAAAGTGGATATCGGGCGCATGGACCGCATGTCGCTGTCCTTCGTCATCGATTCCGAATTGTGGGCA
CAGCCGCTGCCGCTGGCGCTGTATCTGCGCACCGATCTCGATCTGGAAACCGGTCGTTTCAGTCTGTCTT
CGGCAGGCCACTGA