SecReT6
Protein ID: 58582672
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3049
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3282663..3283496 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ5GYB8
KEGG IDxoo:XOO3049
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.10E-39, Aligned region: 144..266
TPR_19 [PF14559], Evalue: 0.00084, Aligned region: 13..68
TPR_19 [PF14559], Evalue: 0.00084, Aligned region: 113..132
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 13..46
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 43..68
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 113..134
TPR_16 [PF13432], Evalue: 0.0095, Aligned region: 12..67
TPR_16 [PF13432], Evalue: 0.0095, Aligned region: 113..137
Protein Sequence: 277 a.a.     [Download]
>gi|58582672|ref|YP_201688.1| hypothetical protein XOO3049 [Xanthomonas oryzae pv. oryzae KACC 10331]
MSAVHPEHACARLLKAGDPAQSLATAKDWVRQCPADAQARIGLFQLLAVAGEWQRAQQQLRLAAELDQGW
GGVVAAYVRILDAELEREQVLAGRMMPLMPGQVPPWQQDLLQALQHDRDGEPGQAARRRALALTQADAIA
GHIDGRRFDWLADADPRFGPCLEVILEVGYAWVPFVQLRSLCLEAPTTLRDLLWQSVDIQWHDGTRSRGV
VPCRYPGSQHSEQGAIRLGQRTEWKGEALSACGLGQRLLAGSEDDYPVLDIRHIAFDTAAVEAPWPN
 
Nucleotide Sequence: 834 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3283496-3282663 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGTCTGCTGTCCATCCCGAACATGCCTGCGCCCGCCTGCTCAAGGCGGGCGACCCGGCGCAATCGTTGG
CCACCGCCAAGGACTGGGTGCGGCAGTGCCCGGCCGATGCCCAAGCGCGCATCGGGCTGTTCCAACTGTT
GGCGGTGGCCGGAGAGTGGCAGCGCGCGCAACAACAATTGCGCCTGGCCGCGGAGTTGGACCAGGGTTGG
GGCGGGGTCGTGGCTGCGTATGTGCGCATCCTCGACGCTGAACTGGAACGCGAACAGGTGCTGGCCGGCC
GAATGATGCCGCTGATGCCTGGTCAGGTCCCGCCGTGGCAGCAGGATCTGCTGCAGGCATTGCAGCATGA
TCGCGACGGCGAACCAGGGCAGGCAGCGCGACGGCGTGCCCTGGCGCTTACGCAAGCCGATGCCATCGCT
GGCCATATCGATGGCCGGCGTTTCGACTGGCTGGCCGACGCCGACCCGCGTTTTGGTCCGTGCCTTGAGG
TCATCCTCGAAGTGGGCTACGCGTGGGTGCCGTTCGTCCAATTGCGCAGCCTGTGCTTGGAAGCCCCGAC
CACGCTGCGCGACTTGCTATGGCAGTCGGTCGACATCCAATGGCATGACGGCACACGCAGCCGTGGCGTG
GTGCCGTGCCGTTACCCCGGTAGCCAACACAGCGAGCAGGGCGCGATCCGCCTTGGCCAGCGCACCGAAT
GGAAGGGCGAGGCGTTGTCCGCATGCGGTCTGGGGCAACGCTTGCTGGCTGGCAGCGAGGACGACTACCC
GGTGCTCGACATCCGCCACATCGCATTCGACACCGCCGCGGTGGAAGCGCCATGGCCGAACTGA