SecReT6
Protein ID: 58582673
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3050
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3283532..3284035 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ5GYB7
KEGG IDxoo:XOO3050
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.00E-36, Aligned region: 7..141
Protein Sequence: 167 a.a.     [Download]
>gi|58582673|ref|YP_201689.1| hypothetical protein XOO3050 [Xanthomonas oryzae pv. oryzae KACC 10331]
MAFDMHLKFGSGDVEIKGASNHTKHKDQVPIIAWSWGTSNTGNLHTGAGYAAGGKANVKDISITKYVDSC
SNALLNACCTGARVDSATLYVTNATGEQSDYVTIELSEGVMITSVSTGGSGGEDRLTENVTLHFGKFKYS
FQPQDDKGKKQGGTKDFTFNMQEVKKS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3284035-3283532 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGCTTTCGATATGCATCTCAAATTCGGCTCGGGCGACGTCGAGATCAAGGGCGCGTCCAACCATACCA
AGCACAAGGACCAAGTGCCGATCATTGCCTGGTCGTGGGGCACCAGCAACACCGGCAACCTGCATACCGG
CGCCGGGTATGCAGCCGGCGGCAAGGCCAATGTGAAGGATATTTCCATCACCAAGTACGTCGATAGTTGC
TCCAATGCCTTGCTCAACGCCTGCTGCACGGGTGCGCGTGTGGATTCGGCCACGCTGTACGTCACCAACG
CCACCGGCGAGCAGTCGGACTACGTGACGATCGAACTCAGCGAAGGCGTGATGATCACCTCGGTGTCCAC
CGGCGGTAGCGGTGGCGAGGACCGTCTGACCGAAAACGTGACCCTGCATTTCGGCAAGTTCAAGTATTCG
TTCCAGCCGCAGGACGACAAGGGCAAGAAGCAGGGCGGCACCAAGGACTTCACGTTCAACATGCAGGAAG
TGAAGAAGTCCTGA