SecReT6
Protein ID: 58582674
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3051
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3284135..3285706 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ5GYB6
KEGG IDxoo:XOO3051
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-192, Aligned region: 92..518
Protein Sequence: 523 a.a.     [Download]
>gi|58582674|ref|YP_201690.1| hypothetical protein XOO3051 [Xanthomonas oryzae pv. oryzae KACC 10331]
MRSRIPPCCVRWSRLPSRRMRNLMVTQHSAAQDLAEAQPQTSQTDDFAALLTREFRPRSERAGEEVRLAV
RTLAEQVLERSDIISDDLAQTINAYVAEIDRKISEQLNLILHAPQFQALEGAWRGLHYLVSNTESDTQLK
IRVLNVSKRELAKNLKRFKGTAWDQSPVFKKIYEAEYGQLGGEPYGCLIGDYHFDHSPQDVDTLRGISQI
AAASHAPFIAAAGPGLMGMESWSELSNPRDLAKIFSTPDYAAWRSLRQSEDAKYLALAMPRTLARLPYGV
KTDPVEAFDFEEDTQGADSSCYTWQNAAYAMAVNINRSFKQYGWCTRIRGVESGGAVEGLPTHTFPADDG
GVDMKCPTEVAITDRRSAELDKMGLMPLVHRKNTDMAAFISAQSLGKPEEYDDPDATANAALSARLPYMF
ACCRFAHYLKCIVRDKIGSFSTRQQMQSWLTDWVMNYVDGDPANSSEETKARKPLAAAEVVVEEVEGNPG
YYTSKFFLRPHYQLEGLTVSLRLVSRLPSAQAA
 
Nucleotide Sequence: 1572 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3285706-3284135 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGCGATCAAGGATCCCACCCTGCTGCGTTCGCTGGTCGCGGCTCCCAAGTCGAAGGATGCGTAACCTCA
TGGTGACCCAACATTCCGCTGCCCAAGACCTTGCCGAAGCGCAGCCGCAAACCAGTCAGACCGACGACTT
TGCGGCCCTGCTGACCCGCGAATTCCGTCCGCGTAGCGAACGCGCCGGCGAAGAAGTGCGGTTGGCTGTG
CGCACCTTGGCCGAACAGGTGCTGGAACGCAGCGACATCATCAGCGACGACCTCGCGCAGACAATCAACG
CGTATGTCGCCGAGATCGACCGCAAGATCAGCGAGCAACTCAACCTCATCCTGCACGCCCCGCAATTCCA
GGCGCTGGAGGGTGCATGGCGCGGACTGCATTATCTGGTCAGCAACACCGAATCGGACACGCAGTTGAAG
ATCCGCGTGCTCAACGTGTCCAAAAGGGAGCTCGCCAAGAACCTCAAGCGCTTCAAGGGCACCGCCTGGG
ACCAGAGCCCGGTATTCAAGAAAATTTACGAAGCCGAGTACGGCCAGCTGGGTGGCGAACCCTACGGCTG
TTTGATTGGCGATTACCACTTCGACCATAGCCCGCAGGATGTCGACACGCTGCGCGGCATCAGCCAGATT
GCCGCCGCCTCGCATGCGCCTTTCATCGCCGCTGCGGGTCCTGGCCTGATGGGGATGGAAAGCTGGAGCG
AGCTGTCCAACCCGCGCGATCTGGCCAAGATTTTTTCCACCCCCGATTACGCGGCTTGGCGTTCGTTGCG
TCAGAGCGAGGATGCCAAGTACCTGGCGCTTGCCATGCCGCGCACGCTGGCGCGGCTGCCGTACGGAGTC
AAGACCGATCCGGTGGAAGCGTTCGACTTCGAAGAAGACACCCAGGGCGCCGATTCGTCGTGCTACACCT
GGCAAAACGCCGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCAGTACGGTTGGTGCACCCG
CATTCGCGGCGTGGAGTCGGGTGGGGCGGTGGAAGGCCTGCCGACGCATACCTTCCCGGCCGACGATGGC
GGTGTGGACATGAAGTGCCCGACCGAGGTCGCGATTACCGACCGCCGTTCGGCCGAACTCGACAAGATGG
GTCTGATGCCGCTGGTACATCGCAAGAACACCGACATGGCAGCCTTCATCAGCGCGCAGTCGCTGGGCAA
GCCCGAGGAATACGACGACCCGGATGCCACCGCCAACGCGGCGCTGAGCGCACGCCTGCCGTATATGTTC
GCTTGCTGCCGCTTCGCGCACTATTTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAGCACGCGCC
AGCAGATGCAGAGCTGGTTGACCGATTGGGTGATGAACTACGTCGACGGCGACCCGGCCAATTCCAGCGA
AGAAACCAAGGCGCGTAAGCCATTGGCTGCTGCCGAAGTGGTCGTCGAAGAGGTCGAGGGCAACCCCGGC
TACTACACCTCCAAGTTCTTCCTGCGCCCGCATTACCAGCTCGAAGGCCTGACGGTATCGCTACGCCTGG
TCTCGCGCTTGCCATCGGCGCAGGCAGCCTGA