SecReT6
Protein ID: 58582675
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3052
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3285642..3286337 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ5GYB5
KEGG IDxoo:XOO3052
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.60E-55, Aligned region: 74..227
Protein Sequence: 231 a.a.     [Download]
>gi|58582675|ref|YP_201691.1| hypothetical protein XOO3052 [Xanthomonas oryzae pv. oryzae KACC 10331]
MRCCCHWILRASPSRISIPAMPVFDFIPPAAAHTMHLRCKGDAFATWPLQPQRPATTQIIGGRMSVRSSS
QKFIARNRAPRVQIEYDVEIYGSQKKVQVPFVMGVLSDLSGANTEHLPALEAREAVEMDVDNFDSRLRAM
QPRVAMSVSNTLTGSGELPVDITFDSLDDFSPTAVVKKVAPLAELLEARTQLANLGTYLDGKAGAERLIA
DAIKDPTLLRSLVAAPKSKDA
 
Nucleotide Sequence: 696 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3286337-3285642 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGCGCTGTTGTTGTCATTGGATCCTGCGGGCAAGCCCATCACGCATATCCATACCTGCCATGCCGGTGT
TCGATTTCATTCCGCCGGCAGCAGCGCACACGATGCATCTCCGGTGCAAGGGGGACGCCTTTGCCACATG
GCCGCTGCAACCGCAGCGTCCAGCAACCACGCAGATCATCGGAGGCCGCATGTCCGTTCGCAGCAGCAGT
CAGAAGTTCATTGCCAGAAATCGCGCGCCTCGCGTGCAGATCGAGTACGACGTCGAGATTTACGGCTCGC
AGAAAAAGGTGCAGGTTCCGTTCGTCATGGGTGTGTTGTCGGATCTGTCCGGCGCCAATACCGAACACCT
GCCGGCGCTGGAAGCACGCGAGGCAGTGGAAATGGATGTCGACAATTTCGACAGCCGGCTGCGTGCCATG
CAACCGCGCGTGGCCATGAGCGTTTCCAATACGCTCACCGGCAGCGGCGAGTTACCGGTCGATATCACCT
TCGACAGCCTGGACGATTTTTCGCCCACCGCGGTCGTGAAAAAGGTGGCACCGCTGGCCGAGCTGCTGGA
AGCACGTACCCAGCTGGCCAATCTAGGCACTTACCTTGACGGCAAAGCCGGCGCCGAGCGCTTGATCGCC
GATGCGATCAAGGATCCCACCCTGCTGCGTTCGCTGGTCGCGGCTCCCAAGTCGAAGGATGCGTAA