SecReT6
Protein ID: 58583089
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3466
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3708207..3708962 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX51
KEGG IDxoo:XOO3466
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-32, Aligned region: 40..177
Phage_GPD [PF05954], Evalue: 1.90E-32, Aligned region: 231..250
Protein Sequence: 251 a.a.     [Download]
>gi|58583089|ref|YP_202105.1| hypothetical protein XOO3466 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDPVATVLSALAAPHQQERLLRLHTPLGPDVLVAETLNGRESVDGGGFRFDVGALSANAGLPLDALLGQP
VLLELLTAESHTALRPFHGHVTAFERLGSNGGLARYRLRVEPWLALLAQRVDSYVFQDMSVVEIAESVFA
DYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAQDADDLFFGKTLLHVQSPRGRELDSQLRCYSNL
GGRRGRQRHRPPPAAVAAAAVNSTRGRALPRHRHRAARRRS
 
Nucleotide Sequence: 756 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3708207-3708962 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGACCCAGTCGCTACCGTTCTTTCCGCATTGGCCGCCCCGCACCAGCAAGAACGCCTGCTACGGTTGC
ATACCCCGCTTGGCCCCGACGTGCTGGTTGCCGAGACCCTGAACGGCCGCGAGTCGGTCGACGGCGGCGG
CTTCCGCTTCGACGTGGGCGCACTATCGGCCAACGCCGGCCTGCCCCTGGACGCGCTGCTCGGCCAGCCG
GTGCTGCTGGAACTGCTCACCGCCGAATCGCACACCGCGCTGCGCCCGTTCCACGGCCATGTCACCGCGT
TCGAACGCCTCGGCAGCAACGGGGGCCTGGCGCGCTACCGGCTGCGGGTGGAGCCGTGGCTGGCGCTGCT
GGCCCAGCGTGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTCGCC
GACTACGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACGCCA
GGCGCAGCCTGACCACGCAATACGAAGAGACAGACTTCGCGCAGGACGCCGATGATCTGTTCTTCGGAAA
AACGCTTCTTCACGTCCAATCTCCTCGGGGTAGGGAATTGGACTCCCAACTGAGGTGCTACTCAAACTTG
GGGGGACGTCGTGGGCGGCAACGCCACCGGCCGCCACCGGCAGCAGTTGCTGCAGCAGCCGTGAACTCGA
CTCGCGGGCGCGCGTTGCCAAGGCATCGGCACCGCGCAGCTCGCCGACGCTCTTGA