SecReT6
Protein ID: 58583089
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3466
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3708207..3708962 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX51
KEGG IDxoo:XOO3466
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-32, Aligned region: 40..177
Phage_GPD [PF05954], Evalue: 1.90E-32, Aligned region: 231..250
Protein Sequence: 251 a.a.     [Download]
>gi|58583089|ref|YP_202105.1| hypothetical protein XOO3466 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDPVATVLSALAAPHQQERLLRLHTPLGPDVLVAETLNGRESVDGGGFRFDVGALSANAGLPLDALLGQP
VLLELLTAESHTALRPFHGHVTAFERLGSNGGLARYRLRVEPWLALLAQRVDSYVFQDMSVVEIAESVFA
DYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAQDADDLFFGKTLLHVQSPRGRELDSQLRCYSNL
GGRRGRQRHRPPPAAVAAAAVNSTRGRALPRHRHRAARRRS
 
Nucleotide Sequence: 756 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3708207-3708962 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGACCCAGTCGCTACCGTTCTTTCCGCATTGGCCGCCCCGCACCAGCAAGAACGCCTGCTACGGTTGC
ATACCCCGCTTGGCCCCGACGTGCTGGTTGCCGAGACCCTGAACGGCCGCGAGTCGGTCGACGGCGGCGG
CTTCCGCTTCGACGTGGGCGCACTATCGGCCAACGCCGGCCTGCCCCTGGACGCGCTGCTCGGCCAGCCG
GTGCTGCTGGAACTGCTCACCGCCGAATCGCACACCGCGCTGCGCCCGTTCCACGGCCATGTCACCGCGT
TCGAACGCCTCGGCAGCAACGGGGGCCTGGCGCGCTACCGGCTGCGGGTGGAGCCGTGGCTGGCGCTGCT
GGCCCAGCGTGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTCGCC
GACTACGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACGCCA
GGCGCAGCCTGACCACGCAATACGAAGAGACAGACTTCGCGCAGGACGCCGATGATCTGTTCTTCGGAAA
AACGCTTCTTCACGTCCAATCTCCTCGGGGTAGGGAATTGGACTCCCAACTGAGGTGCTACTCAAACTTG
GGGGGACGTCGTGGGCGGCAACGCCACCGGCCGCCACCGGCAGCAGTTGCTGCAGCAGCCGTGAACTCGA
CTCGCGGGCGCGCGTTGCCAAGGCATCGGCACCGCGCAGCTCGCCGACGCTCTTGA

Protein ID: 58583097
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3474
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3721305..3722894 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX43
KEGG IDxoo:XOO3474
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-72, Aligned region: 41..355
Phage_base_V [PF04717], Evalue: 2.10E-16, Aligned region: 225..250
Phage_base_V [PF04717], Evalue: 2.10E-16, Aligned region: 434..529
Protein Sequence: 529 a.a.     [Download]
>gi|58583097|ref|YP_202113.1| hypothetical protein XOO3474 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDPVATVLSALSAAPRQQERLLRLHTPLGPDVLVAETLDGRESVDGGGFRFDVAALSANAGLPLDDLLGQ
PVLLELLTAESHTALRPFHGHVTAFERLGSNGGLARYRLRVEPWLALLAQRVDSYVFQDMSVVEIAESVF
ADYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAFLSRLLAEEGIAYWFEHTGAADSATRGTHTLV
LSDHNAAFADLGTVRYHRTDVTEQQDSVQQWVQAHRWRATSLSRASWDYRSRSLRLAGADATPLGDIGAE
DVDTAGPYGWQDSMRGQRRAQQQFDAQQVAAQTIEGQGTWRQLAPGTRFGLRQHAGVAADAAFLCLQVRH
QARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYAPAQDEAAVEFYRNQFTAIPATATYRPQTED
GHGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWV
RVMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIG
 
Nucleotide Sequence: 1590 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3722894-3721305 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGACCCGGTCGCCACAGTACTTTCCGCCCTCAGCGCCGCCCCGCGGCAGCAAGAACGCCTGCTGCGGT
TGCATACCCCGCTTGGCCCCGACGTGCTAGTCGCCGAGACGCTCGACGGCCGCGAGTCGGTCGATGGCGG
CGGCTTCCGTTTCGACGTGGCCGCACTATCGGCCAACGCCGGCCTGCCGCTGGACGACCTGCTCGGCCAG
CCGGTGCTGCTGGAACTGCTCACCGCCGAATCGCACACCGCGCTGCGCCCGTTCCACGGCCATGTCACCG
CGTTCGAACGCCTCGGCAGCAACGGCGGCCTGGCGCGCTACCGGCTGCGGGTGGAGCCGTGGCTGGCGCT
GCTGGCCCAGCGTGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTC
GCCGACTATGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACG
CCAGGCGCAGCCTGACCACGCAATACGAAGAGACCGACTTCGCGTTCCTGAGCCGGCTGCTGGCCGAGGA
AGGCATCGCCTATTGGTTCGAGCACACCGGCGCGGCCGACAGCGCCACGCGCGGCACGCACACGCTGGTG
CTGTCGGACCACAACGCCGCCTTCGCCGACCTGGGCACGGTGCGCTACCACCGCACCGACGTCACCGAGC
AGCAGGACAGCGTGCAGCAGTGGGTACAGGCACATCGCTGGCGCGCGACCAGTCTGTCGCGGGCCAGCTG
GGACTACCGCAGCCGCAGCCTGCGCCTGGCCGGCGCCGACGCCACGCCGCTGGGCGACATCGGTGCCGAG
GACGTGGACACCGCCGGGCCGTACGGCTGGCAGGACAGCATGCGCGGCCAGCGCCGCGCGCAGCAGCAGT
TCGATGCGCAGCAGGTGGCGGCGCAGACCATCGAGGGCCAGGGGACCTGGCGGCAACTGGCGCCGGGCAC
GCGTTTCGGGCTGCGCCAGCATGCGGGCGTGGCGGCCGATGCGGCGTTCCTGTGCCTGCAGGTGCGGCAC
CAGGCGCGCAACAACCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGGCGCGGTGGCGGTGG
CCGGCGCGCCGCTGCCGCCAGCGCTGGCAGGCCTGAGCGGCGGGTATGCGCCGGCGCAGGATGAGGCGGC
GGTAGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGCCGCAAACCGAGGAC
GGGCACGGCGTGCGGCTGCATCCCAAGCCCACGGTCGTCGGCACGCTGAGCGCCATCGTGGTCAGCGACG
GCGACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAGCGCGGGGCCGACGC
CAGCAGCGCGCTGGCGCATCCGGGGGGCGAGGACAACGCGCCGGGCAGCGCCTCGGCGTGGACCTGGGTG
CGGGTGATGACGCCGTGGGCCGGGGACAACTGGGGCGGCGTGGTGCTGCCGCGCAAAGGCCAGGAAGTGC
TGGTGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCTAA

Protein ID: 58583109
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3486
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3736169..3738706 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX31
KEGG IDxoo:XOO3486
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.40E-57, Aligned region: 41..342
Phage_GPD [PF05954], Evalue: 4.40E-57, Aligned region: 620..772
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 233..286
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 580..602
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 667..821
T6SS_Vgr [PF13296], Evalue: 1.60E-30, Aligned region: 515..621
T6SS_Vgr [PF13296], Evalue: 1.60E-30, Aligned region: 698..718
Phage_base_V [PF04717], Evalue: 2.70E-16, Aligned region: 386..495
Protein Sequence: 845 a.a.     [Download]
>gi|58583109|ref|YP_202125.1| hypothetical protein XOO3486 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQVPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGGLPPLEVYVQPRAGRFAQ
EATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVAL
LDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQP
TPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNG
ELAPPFGGGLDARASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTA
RGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTVQALHATLTQQQVPG
LDAHPSVTRLREAIDPQAQGKYTAAVGGQPATKPGDGGRDGQAPVERFAQARLLGESPDHIAWTTPASAV
AYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTA
TDTRIDVLAQHKIVLQAGQTRITLEGGDISFACPGQFTVKASTHPFLGGESGNPQFALPDGLVHLEPDRM
LDFSG
 
Nucleotide Sequence: 2538 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3736169-3738706 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGATATCCCGACGCTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CGTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCGCTGGTGTTCCAGGACCTGGACGCGCGCGCGATTTGCGAACGGATCTTCGCCGACTACCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCGAGGCCGGCGGGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAG
GAAGCGACAGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCG
GGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGG
CCAGCGTTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTG
CTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGC
TGCGCGCGCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGA
CGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCC
ACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCA
CCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAG
CGAAGTGCTGGTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGC
GAGCTCGCCCCACCCTTCGGCGGGGGCCTGGACGCGCGTGCCAGCCACCCCGGCACGCTCAGCGGCCTGC
ACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACTCCCGGCCAGCTGCGCAC
GCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCC
CGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAG
GCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGC
CCAGTTGCACGGCGCCCAACGAACCGTCCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGC
CTGGACGCCCATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAGGCGCAGGGCAAGTACACCG
CTGCGGTCGGCGGCCAGCCGGCGACCAAGCCGGGCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACG
CTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTG
GCCTATGCCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGT
CGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGG
CCCGGTGAGCCTGCAGGCACATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCC
ACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCCGGACAGACCCGCATCACCC
TGGAAGGCGGCGACATCAGCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGGCCAGCACGCATCCGTTCTT
GGGTGGGGAGAGCGGCAACCCCCAATTCGCCTTGCCCGATGGGCTGGTGCATCTGGAACCAGACCGCATG
CTCGATTTCTCGGGCTGA

Protein ID: 58583111
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3488
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3742460..3743893 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX29
KEGG IDxoo:XOO3488
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 2.10E-49, Aligned region: 213..235
DUF2345 [PF10106], Evalue: 2.10E-49, Aligned region: 300..454
T6SS_Vgr [PF13296], Evalue: 6.50E-31, Aligned region: 148..254
T6SS_Vgr [PF13296], Evalue: 6.50E-31, Aligned region: 330..351
Phage_base_V [PF04717], Evalue: 1.50E-16, Aligned region: 19..128
Protein Sequence: 477 a.a.     [Download]
>gi|58583111|ref|YP_202127.1| hypothetical protein XOO3488 [Xanthomonas oryzae pv. oryzae KACC 10331]
MPAATPLRALPQDRSRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQPTPGGLTDSASTAPGHAP
GDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNGEVAPPFGGGLDARAGHP
GTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTARGALRGQGFELASQGWG
NVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTVQALHATLTQQQVPGLDAHPSVTRLREAIDPQ
AQGKYTAAVGGQPATKPGDGGRDGQAPVERFAQARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQL
SAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTATDTRIDVLAQHKIVLQA
GQTRITLEGGDITFACPGQFTVKASMHPFLGGESGSAALPPLPDSLKKPDGTAPFSV
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3742460-3743893 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGCCGGCGGCCACGCCCTTGCGCGCGCTGCCGCAGGACCGCTCGCGCATGCCCGGGCCGCAGAGCGCGC
GCGTGGTCGGCGTGGCCGACGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTG
GCAGCGCGGCGACCAGCCCACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCG
GGCGACCAGCGCGCCGGCACCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACT
TCCTGCCGCGCATCGGCAGCGAAGTGCTGGTGGAGTTCCTGCACGGAGACATCGATCAGCCGCGCATCAC
CGGCCAGTTGTACAACGGCGAGGTCGCCCCACCCTTCGGCGGCGGCCTGGACGCGCGTGCCGGCCACCCC
GGCACGCTCAGCGGCCTGCACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACA
CCCCCGGCCAGCTGCGCACGCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGT
CCAGCACAGCGACACCGCCCGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGC
AACGTGCATGCCGCGCAAGGCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGG
ACGTGGCCGAGGCGGTGGCCCAGTTGCACGGCGCCCAACGCACCGTCCAGGCGCTGCACGCCACCCTGAC
CCAGCAACAGGTGCCCGGCCTGGACGCCCATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAG
GCGCAGGGCAAGTACACCGCTGCGGTCGGCGGCCAGCCGGCGACCAAGCCGGGCGACGGCGGCCGCGACG
GCCAGGCACCGGTGGAACGCTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGAC
CACCCCGGCCAGCGCGGTGGCCTATGCCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTG
AGCGCCGGGCAGACCCTGTCGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGGCCGATCA
AACTCATCGCCGCCGCCGGCCCGGTGAGCCTGCAGGCACATACCGGCGCGCTGGAACTGCTGGCCGACCA
GGCGGTGACCGTCACCGCCACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCC
GGACAGACCCGCATCACCCTGGAAGGCGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGG
CCAGCATGCATCCGTTCTTGGGTGGGGAGAGCGGCAGTGCCGCCCTGCCGCCTTTGCCTGACAGCTTGAA
GAAGCCCGATGGCACTGCACCTTTCTCCGTCTAA

Protein ID: 58583113
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3490
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3746714..3748975 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX27
KEGG IDxoo:XOO3490
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 38..89
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 391..424
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 478..630
T6SS_Vgr [PF13296], Evalue: 1.90E-30, Aligned region: 33..69
T6SS_Vgr [PF13296], Evalue: 1.90E-30, Aligned region: 326..432
T6SS_Vgr [PF13296], Evalue: 1.90E-30, Aligned region: 509..529
Phage_base_V [PF04717], Evalue: 6.70E-17, Aligned region: 129..173
Phage_base_V [PF04717], Evalue: 6.70E-17, Aligned region: 197..306
Phage_GPD [PF05954], Evalue: 1.20E-15, Aligned region: 4..149
Phage_GPD [PF05954], Evalue: 1.20E-15, Aligned region: 429..583
Phage_GPD [PF05954], Evalue: 1.20E-15, Aligned region: 596..623
Protein Sequence: 753 a.a.     [Download]
>gi|58583113|ref|YP_202129.1| hypothetical protein XOO3490 [Xanthomonas oryzae pv. oryzae KACC 10331]
MSATLVIFDPQAQVPDSGTIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAQAE
AGALPPLEVYVQPRAGRFAQEATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQHF
VPVAIEHVAVKQPGPRASSPFWTRRSWSTAATATVSWRCRAATPLRTLPQDRPRMPGPQSARVVGVADAA
LSPSRDHQVRIQFPWQRGDQPTPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEV
LVEFLHGDIDQPRITGQLYNGELAPPFGGGLDAHASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRL
HTSLADTRLELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQL
HGAQRTAQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQAATTPADGGRDGQAPVERFA
QARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPV
SLQAHTGALELLADQAVTVTATDTRIDVLAQHKIVLQAGQTRITLEGGDITFACPGQFTVKASMHPFLGG
EMNAVAIPPLPEERLPLQTLSLDHRYHDDQGLAGADYVVTLADGGKRHGTLDAQGRAEVANVPGGSAEVV
FSPMPGLFGRKDMTPTPDHAANPADAKLDGVVDKYLAAATADSVKADPVKGVQ
 
Nucleotide Sequence: 2262 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3746714-3748975 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGTCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGCACGATCCGCTTCCACC
GCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCGGCGTCGTGCCCACCGC
CAGCACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGCCCAGGCCCAGGCCGAG
GCCGGCGCGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAGGAGGCGACCG
CGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCGGGGCCGGCAG
CGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGGCCAGCATTTC
GTTCCGGTGGCGATCGAGCACGTGGCGGTGAAACAACCTGGGCCAAGGGCATCGTCCCCCTTCTGGACCC
GCCGGAGCTGGAGCACGGCAGCTACCGCAACCGTTTCCTGGCGGTGCCGGGCGGCCACGCCGCTGCGCAC
GCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGACGCGGCG
CTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCCACCCCGG
GCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCACCTGGGT
GCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAGCGAAGTG
CTGGTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGCGAGCTCG
CCCCACCCTTCGGCGGCGGCCTGGACGCGCATGCCAGCCACCCCGGCACGCTCAGCGGCCTGCACACCCA
GTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCACGCGCCTG
CACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCCCGCGGCG
CGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAGGCCTGCT
GCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGCCCAGTTG
CACGGCGCCCAACGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGCCTGGACG
CCCATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAAGCGCAGGGCAAGTACACCGCTGCGGT
CGGCGGCCAGGCAGCGACCACGCCGGCCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACGCTTCGCC
CAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTGGCCTATG
CCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGTCGGCGGT
GTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGGCCCGGTG
AGCCTGCAGGCGCATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCCACCGACA
CCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCCGGACAGACCCGCATCACCCTGGAAGG
CGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGGCCAGCATGCATCCGTTCTTGGGTGGG
GAGATGAATGCCGTCGCCATCCCCCCGCTGCCGGAAGAACGCCTTCCCCTGCAAACGCTGTCGCTCGATC
ATCGCTACCACGACGATCAGGGCCTGGCCGGTGCCGACTACGTGGTCACCCTGGCCGATGGCGGCAAACG
GCACGGCACGCTCGACGCGCAGGGACGCGCCGAGGTGGCGAATGTCCCCGGCGGCTCGGCCGAGGTGGTG
TTCTCGCCGATGCCGGGCCTGTTCGGCCGCAAGGACATGACGCCCACGCCCGATCACGCGGCCAATCCTG
CCGACGCAAAGCTGGACGGCGTGGTGGACAAGTATCTGGCCGCCGCCACCGCCGATTCCGTTAAAGCCGA
TCCCGTTAAAGGAGTGCAGTGA

Protein ID: 58583118
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3495
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3756230..3757396 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX22
KEGG IDxoo:XOO3495
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-58, Aligned region: 41..342
Protein Sequence: 388 a.a.     [Download]
>gi|58583118|ref|YP_202134.1| hypothetical protein XOO3495 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQAPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGALPPLEVYVQPRAGRFAQ
EATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVAL
LDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQ
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3756230-3757396 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGATATCCCGACGCTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CGTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCGCTGGTGTTCCAGGACCTGGACGCGCGCGCGATCTGCGAACGGATCTTCGCCGACTATCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGCGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCGAGGCCGGCGCGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAG
GAGGCGACCGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCG
GGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGG
CCAGCGTTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTG
CTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGC
TGCGCGCACTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGTAG

Protein ID: 58583126
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3503
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3763083..3764609 [-]
ProductVGR-related protein
NoteTssI
UniProt IDQ5GX14
KEGG IDxoo:XOO3503
PDB IDNA
Domain hit(s) vs Pfam T6SS_Vgr [PF13296], Evalue: 4.30E-35, Aligned region: 306..412
Phage_base_V [PF04717], Evalue: 7.50E-25, Aligned region: 149..246
Phage_GPD [PF05954], Evalue: 5.10E-08, Aligned region: 11..77
Phage_GPD [PF05954], Evalue: 5.10E-08, Aligned region: 132..189
Protein Sequence: 508 a.a.     [Download]
>gi|58583126|ref|YP_202142.1| VGR-related protein [Xanthomonas oryzae pv. oryzae KACC 10331]
MYELVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQAPQQGQAPPAQLLLTRV
WHAGINNLPVDVRAAVQSQLGVAPAWPDTSAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGAR
LHPRPTAPGYQSAIVVGADGSTDGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGVGS
QFLPRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYAKAGDGRPSAQGNLAGG
HAPAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFDDSDQQLRLQLATTQAATQLNLGHLIHQADN
YRGSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTLGKTFSQAAGTHQTVKL
AAHEGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADAKGAAAERRASPGDDRVPHTGDALLGLAAPA
GIGVVAGQGLAPGAWARR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3764609-3763083 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGTACGAGCTGGTGGGGATGGACGCCTTCGCCAGCGCGCAGGCAGCAGACCGCTCTGCGGAGTTGATGG
CGCAGGCGCACGAGGCACAGTGGTCACCGTGGCAGGGCCGCAGCACGGTGCGCACGCTGCGCGCCGGCAC
CTGGTTCACGCTGACCCAGGCACCGCAGCAGGGCCAGGCGCCGCCGGCGCAGCTGTTGCTGACGCGGGTG
TGGCATGCGGGTATCAACAACTTGCCGGTGGACGTGCGCGCGGCGGTGCAGTCGCAGTTGGGGGTCGCGC
CGGCGTGGCCGGACACCAGCGCGGTGGCCGCACGCAGCACCTGGGCGCAGGCCGAGGCGGTGGGCTACGG
CAACGCCTTCGAGGCGGTGGACCGGCAGCAGCCGTGGCGGCCGGTGCTGGCCGACGGCACCGGTGCGCGG
CTGCACCCGCGGCCGACCGCGCCGGGCTACCAGAGCGCCATCGTGGTCGGTGCCGATGGCAGCACCGACG
GCAGCCAGGAGGTCCATGCCGACGCGCTGGGCCGGATCCGGGTCAGGTTCCACTTCCAGCACGCCGCGTC
GGCCCCGGCGGCGCAGGACAGCACGTGGCTGCGGGTGGCGCAGCGCTACGCCGGCCCGGGCGTGGGCAGC
CAGTTCCTGCCACGCATCGGCCAGGAAGTGCTGGTGGGCTTCCTGGAGGGGGACATCGACCGTCCGGTGG
TGCTGGGGGCGCTGTACAACGGCAAGGGCGAAGCCGGCGTTCCCGCCACCCCCGGCGGCACCAGCGCCGA
GGCCGACACCGGCCTGTACGCCAAGGCCGGCGACGGCAGACCCAGCGCGCAGGGCAACCTGGCCGGCGGC
CATGCCCCGGCCTGGCACGGCGCCGGCGGCGGCGCGGACAACCACCGCAACGCCACCGCGCTGTGGGGCG
TGCAATCCAAGGAATGGGGCGGCGCTGGCCACAGCCGGCTGGTGTTCGACGACAGCGACCAGCAATTGCG
CTTGCAACTTGCGACCACCCAGGCAGCCACGCAACTGAACCTGGGGCACCTGATCCACCAGGCCGACAAC
TACCGCGGCAGCTTCCGCGGGGAAGGCTTCGAACTGCGCACCGACGCGTGGGGCGCGGTGCGGGCCAGCT
CGGGGCTATGGCTGAGCAGCTACGGCCGCAGCGGCGGCCCGGCCGGCGAGGCGACCCAGCCCAGCGCATT
GCTGAGCCAGCTGCAGACGCTGGGCAAGACGTTCTCGCAGGCGGCGGGCACGCACCAGACGGTGAAGCTG
GCCGCGCACGAAGGCGTGGGCCAGGCGAACCACTCCCAGCTGATCGCCGAGCAGGCGCCGCTGCCGGCGC
TGCTGACCAGCGTGAAGACCACGGTGCCGGGCACGGCCTACGCCGACGCCAAGGGCGCGGCGGCCGAGCG
CCGCGCCAGCCCGGGCGACGACCGGGTGCCGCACACCGGCGATGCGCTGCTGGGCCTGGCGGCGCCAGCG
GGGATCGGCGTGGTGGCCGGCCAGGGCCTGGCGCCTGGAGCGTGGGCGAGACGCTGA

Protein ID: 58583127
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3504
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3764610..3765293 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX13
KEGG IDxoo:XOO3504
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-24, Aligned region: 80..213
YiaAB [PF05360], Evalue: 3.30E-05, Aligned region: 20..40
YiaAB [PF05360], Evalue: 3.30E-05, Aligned region: 59..81
Protein Sequence: 227 a.a.     [Download]
>gi|58583127|ref|YP_202143.1| hypothetical protein XOO3504 [Xanthomonas oryzae pv. oryzae KACC 10331]
MIMRTRIANHSSVAFVGALWVGLLLFGVFAAVSVQKSVRDRVDGIGVTAIHHGEAGCSVVAALSLLTVGL
CNATPPLSAKIVEAVFADYAPMASWQWSEETSAFLGQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQE
AAPSPGGHQLVVFADSAAQPQDPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGRLTVLSEDFKTRQ
ARSAQLPLHGGGRQSLR
 
Nucleotide Sequence: 684 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3765293-3764610 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGATCATGCGAACGCGTATTGCCAACCATTCGTCCGTGGCCTTCGTCGGCGCGTTGTGGGTGGGGCTGC
TGCTGTTCGGCGTATTCGCGGCGGTATCGGTACAGAAGAGCGTGCGCGATCGCGTCGACGGCATCGGCGT
GACGGCGATCCACCATGGAGAGGCCGGGTGTTCGGTCGTCGCCGCGCTGTCGCTGCTGACCGTCGGTCTG
TGCAACGCGACGCCGCCTCTGAGCGCAAAAATCGTGGAAGCGGTGTTCGCCGACTACGCGCCGATGGCAA
GCTGGCAGTGGAGCGAGGAGACGAGCGCGTTCCTGGGGCAGGCGCGGCCGCGCAGCTACTGCGTGCAGTA
CCGCGAGAGCGACCTGGATTTCGTGCAGCGGCTGCTGGCCGAGGAAGGCCTGGGCTGGAGGCTGCAGGAG
GCGGCCCCGTCGCCCGGCGGGCACCAGCTGGTGGTGTTCGCCGACAGCGCCGCGCAACCGCAGGACCCCA
GTTCGGCGCAGGGCGGCGGGCTGCGCTACCACCGCAGCGACGCCACCGAGGCGGCCGACAGCGTGCTGGC
GATCGGCGCCACCCGGCGGCTGGGCAGCGGCCGGCTGACGGTGCTCAGCGAAGACTTCAAGACGCGCCAG
GCGCGCAGCGCGCAGTTGCCGTTGCACGGCGGCGGCAGGCAGTCGCTGCGCTAG