SecReT6
Protein ID: 58583097
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3474
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3721305..3722894 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX43
KEGG IDxoo:XOO3474
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-72, Aligned region: 41..355
Phage_base_V [PF04717], Evalue: 2.10E-16, Aligned region: 225..250
Phage_base_V [PF04717], Evalue: 2.10E-16, Aligned region: 434..529
Protein Sequence: 529 a.a.     [Download]
>gi|58583097|ref|YP_202113.1| hypothetical protein XOO3474 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDPVATVLSALSAAPRQQERLLRLHTPLGPDVLVAETLDGRESVDGGGFRFDVAALSANAGLPLDDLLGQ
PVLLELLTAESHTALRPFHGHVTAFERLGSNGGLARYRLRVEPWLALLAQRVDSYVFQDMSVVEIAESVF
ADYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAFLSRLLAEEGIAYWFEHTGAADSATRGTHTLV
LSDHNAAFADLGTVRYHRTDVTEQQDSVQQWVQAHRWRATSLSRASWDYRSRSLRLAGADATPLGDIGAE
DVDTAGPYGWQDSMRGQRRAQQQFDAQQVAAQTIEGQGTWRQLAPGTRFGLRQHAGVAADAAFLCLQVRH
QARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYAPAQDEAAVEFYRNQFTAIPATATYRPQTED
GHGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWV
RVMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIG
 
Nucleotide Sequence: 1590 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3722894-3721305 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGACCCGGTCGCCACAGTACTTTCCGCCCTCAGCGCCGCCCCGCGGCAGCAAGAACGCCTGCTGCGGT
TGCATACCCCGCTTGGCCCCGACGTGCTAGTCGCCGAGACGCTCGACGGCCGCGAGTCGGTCGATGGCGG
CGGCTTCCGTTTCGACGTGGCCGCACTATCGGCCAACGCCGGCCTGCCGCTGGACGACCTGCTCGGCCAG
CCGGTGCTGCTGGAACTGCTCACCGCCGAATCGCACACCGCGCTGCGCCCGTTCCACGGCCATGTCACCG
CGTTCGAACGCCTCGGCAGCAACGGCGGCCTGGCGCGCTACCGGCTGCGGGTGGAGCCGTGGCTGGCGCT
GCTGGCCCAGCGTGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTC
GCCGACTATGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACG
CCAGGCGCAGCCTGACCACGCAATACGAAGAGACCGACTTCGCGTTCCTGAGCCGGCTGCTGGCCGAGGA
AGGCATCGCCTATTGGTTCGAGCACACCGGCGCGGCCGACAGCGCCACGCGCGGCACGCACACGCTGGTG
CTGTCGGACCACAACGCCGCCTTCGCCGACCTGGGCACGGTGCGCTACCACCGCACCGACGTCACCGAGC
AGCAGGACAGCGTGCAGCAGTGGGTACAGGCACATCGCTGGCGCGCGACCAGTCTGTCGCGGGCCAGCTG
GGACTACCGCAGCCGCAGCCTGCGCCTGGCCGGCGCCGACGCCACGCCGCTGGGCGACATCGGTGCCGAG
GACGTGGACACCGCCGGGCCGTACGGCTGGCAGGACAGCATGCGCGGCCAGCGCCGCGCGCAGCAGCAGT
TCGATGCGCAGCAGGTGGCGGCGCAGACCATCGAGGGCCAGGGGACCTGGCGGCAACTGGCGCCGGGCAC
GCGTTTCGGGCTGCGCCAGCATGCGGGCGTGGCGGCCGATGCGGCGTTCCTGTGCCTGCAGGTGCGGCAC
CAGGCGCGCAACAACCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGGCGCGGTGGCGGTGG
CCGGCGCGCCGCTGCCGCCAGCGCTGGCAGGCCTGAGCGGCGGGTATGCGCCGGCGCAGGATGAGGCGGC
GGTAGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGCCGCAAACCGAGGAC
GGGCACGGCGTGCGGCTGCATCCCAAGCCCACGGTCGTCGGCACGCTGAGCGCCATCGTGGTCAGCGACG
GCGACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAGCGCGGGGCCGACGC
CAGCAGCGCGCTGGCGCATCCGGGGGGCGAGGACAACGCGCCGGGCAGCGCCTCGGCGTGGACCTGGGTG
CGGGTGATGACGCCGTGGGCCGGGGACAACTGGGGCGGCGTGGTGCTGCCGCGCAAAGGCCAGGAAGTGC
TGGTGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCTAA