SecReT6
Protein ID: 58583099
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3476
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3726186..3727277 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ5GX41
KEGG IDxoo:XOO3476
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-92, Aligned region: 18..344
Protein Sequence: 363 a.a.     [Download]
>gi|58583099|ref|YP_202115.1| hypothetical protein XOO3476 [Xanthomonas oryzae pv. oryzae KACC 10331]
MLTAKRRIDPGIALQLLAEPHRFQFFQAMRILERVFQRQGVKAGQALPTRVRFHNSLSLAFPATELDPVG
QAYSQDGERLESDAALAFAIETESLGEVHLTPNFMGLLGTSGALPLHYTETLHERELYQRDRTPRAFLDM
FSNRAVALHYAAWKKHRLALQYELDRRERFLPLVLSLLGMGMPGLRDRMVDGGGDVFDQAVAYYAGAIRQ
RPISAKLLQRVLADYFKVPVELEQFVGAWYKVPAQQATRLGQANATLGSSALAGDRVWQRDLRMRLRFGP
LQREAFDQFLPGGSAAKALSKWLMLLTGGGLEYEVKLVLRAEDVRGSGVGEALGVRLGWDSYLCSRPQTQ
PRADTTYGLHTLQ
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3727277-3726186 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGCTTACCGCGAAGCGGCGAATCGATCCTGGCATAGCGCTGCAACTGCTGGCCGAGCCGCATCGCTTCC
AGTTTTTCCAGGCGATGCGGATTCTGGAGCGGGTGTTCCAGCGCCAGGGGGTCAAGGCCGGTCAGGCCCT
GCCCACACGCGTACGTTTTCACAACTCGCTGTCGTTGGCGTTTCCGGCGACCGAGCTGGACCCCGTCGGC
CAGGCCTATTCGCAGGACGGCGAGCGCCTGGAAAGCGATGCGGCGCTGGCGTTCGCGATCGAGACCGAGA
GCCTGGGCGAAGTGCATCTGACCCCGAACTTCATGGGGTTGCTGGGCACCTCCGGCGCATTGCCGCTGCA
CTACACCGAGACCCTGCACGAACGCGAGCTGTACCAGCGCGACCGTACCCCACGCGCGTTCCTGGACATG
TTCTCCAACCGCGCGGTGGCGCTGCACTACGCCGCGTGGAAGAAGCACCGGCTGGCGCTGCAGTATGAGC
TGGACCGGCGCGAGCGCTTCCTGCCGCTGGTGCTGTCGCTGCTGGGCATGGGCATGCCGGGACTACGCGA
TCGCATGGTCGACGGCGGCGGCGACGTCTTCGACCAGGCGGTGGCGTACTACGCCGGCGCCATCCGCCAG
CGGCCGATCTCGGCCAAGCTGCTGCAGCGCGTGCTGGCCGACTACTTCAAGGTGCCGGTGGAGCTGGAGC
AGTTCGTCGGCGCCTGGTACAAGGTGCCGGCGCAACAGGCCACGCGGCTGGGCCAGGCCAACGCCACTCT
CGGGTCCAGTGCGCTGGCCGGCGACCGGGTGTGGCAGCGCGACCTGCGCATGCGCCTGCGCTTCGGTCCG
CTGCAGCGTGAGGCTTTCGACCAGTTCCTGCCCGGAGGCAGCGCCGCGAAGGCCTTGTCGAAATGGCTGA
TGCTGCTCACCGGCGGCGGGCTGGAATACGAGGTCAAGCTGGTGCTGCGCGCCGAGGACGTACGCGGCTC
CGGCGTCGGCGAAGCACTGGGCGTACGCCTGGGCTGGGACAGCTACCTATGCTCGCGCCCGCAGACCCAG
CCGCGCGCCGACACCACCTACGGTCTGCATACCCTTCAATAG