SecReT6
Protein ID: 58583100
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3477
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3727241..3729076 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ5GX40
KEGG IDxoo:XOO3477
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.40E-206, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|58583100|ref|YP_202116.1| hypothetical protein XOO3477 [Xanthomonas oryzae pv. oryzae KACC 10331]
MQDLLPYYERELGYLRRYGREFAERYPKIAGRLQLSADGSQDPHVERLIEAFALMGARISKRIEDDYPEF
TDALLEVLYPHYLRPFPSCSIAYFDMEGVAAKLSAPIRVPRGSYLLSRPVRGINCRFRTAYDVVLVPVAV
KAASYRGVAEAPMAVSLPPGTGAQISISFELLSDQASFAGLGTDALRFFVDGEPSFCSAMRDALALGVKA
AYVESDGSGRWRRLADTPLVPVGFADDESLIDFPARSHPAYRLLTELFGYPDKFGFFDLQLKPVTAGASR
WFTLHLVLQATPPDRAANQVLEELDCKNIRLGCTPVVNLFAQHGEPIRVTHRSVTYPVIADGRRAFAYEV
HSIDSVHRIRQTPQGELIQEFRPFYSLHHGEDPERAGQYWVARRDEDVARQSPGYETEVSFVDLEFNPTL
PQTDVVSVELTCSNRDLPSQLAYGIAGGDLSIEGGTPARAISLLRKPSRPLRFRHGRGAQWRLISHLSLN
QLSLTGSGLPALKEMLRLYDISGSSVSSRQIDGIVGIEQYPVTTWLSGKHFASVVRGLEVRLTISENHFV
GTGVAAFAHVLDHFFGLYVHANSFIRLVLISSDTGEELVRCLPRSGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3729076-3727241 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGCAAGACCTGCTTCCCTACTACGAACGCGAACTGGGCTATCTGCGTCGCTACGGGCGCGAGTTCGCCG
AGCGCTATCCCAAGATTGCCGGGCGCCTGCAGCTGTCGGCCGACGGCAGCCAGGATCCGCATGTCGAGCG
CCTGATCGAGGCGTTCGCGCTGATGGGCGCGCGCATCTCCAAGCGCATTGAGGACGACTACCCCGAGTTC
ACCGACGCGCTGCTGGAAGTGCTGTATCCGCACTATCTGCGGCCGTTTCCGTCCTGCTCCATCGCCTATT
TCGACATGGAAGGCGTGGCTGCCAAGCTCAGCGCGCCGATCCGCGTGCCGCGCGGCAGCTACTTGCTGTC
GCGCCCGGTGCGCGGGATCAATTGCCGGTTCCGCACCGCCTACGACGTGGTACTGGTGCCGGTGGCGGTG
AAGGCCGCCAGCTACCGCGGCGTGGCCGAAGCGCCGATGGCGGTCAGCCTGCCGCCGGGCACCGGCGCAC
AGATCTCGATCAGCTTCGAGCTGTTGTCCGACCAGGCCTCGTTCGCTGGCCTGGGCACCGACGCGCTGCG
TTTCTTCGTCGACGGCGAGCCGTCGTTCTGCTCGGCGATGCGCGATGCGCTGGCGCTGGGGGTCAAGGCG
GCCTATGTCGAGTCCGACGGCAGCGGACGCTGGCGCCGGCTGGCGGACACCCCGCTGGTGCCAGTGGGAT
TCGCCGACGACGAATCGCTGATCGATTTCCCGGCGCGTTCGCACCCGGCCTACCGCCTGCTGACCGAGCT
GTTCGGCTACCCGGACAAGTTCGGCTTCTTCGATCTTCAGCTCAAGCCGGTGACCGCCGGCGCCAGCCGC
TGGTTCACGTTGCACCTGGTCCTACAAGCGACGCCGCCCGATCGCGCCGCCAACCAAGTGCTCGAGGAGT
TGGATTGCAAGAACATCCGCCTGGGCTGCACCCCGGTGGTGAACCTGTTCGCGCAGCACGGCGAGCCGAT
CCGCGTCACCCATCGCAGCGTCACCTATCCGGTGATCGCCGACGGGCGCCGCGCCTTTGCCTACGAAGTG
CATTCGATCGATTCGGTACACCGTATCCGGCAGACTCCGCAGGGCGAGCTAATCCAGGAGTTCCGCCCGT
TCTATTCGCTGCACCATGGCGAAGACCCCGAGCGCGCCGGCCAGTATTGGGTGGCGCGGCGCGACGAGGA
TGTGGCGCGGCAGAGTCCCGGTTACGAAACCGAAGTGAGCTTCGTGGACCTGGAATTCAATCCGACCCTG
CCGCAGACCGATGTGGTCAGCGTCGAACTCACCTGCAGCAATCGCGATCTGCCCAGCCAGCTCGCCTATG
GCATCGCCGGAGGCGACCTGTCGATCGAGGGCGGAACGCCGGCGCGCGCGATCAGCCTGTTGCGCAAGCC
GAGCCGGCCACTGCGGTTCCGCCACGGGCGCGGCGCGCAATGGCGGCTGATCTCGCACCTGTCGTTGAAT
CAGCTGTCGCTGACCGGCAGCGGCTTGCCGGCGTTGAAGGAGATGCTGCGGCTGTACGACATCTCCGGCA
GCAGCGTGTCGTCGCGGCAGATCGACGGCATCGTCGGCATCGAGCAGTATCCGGTCACCACCTGGCTGTC
CGGCAAGCATTTCGCATCGGTGGTGCGCGGCCTGGAAGTGCGTTTGACCATCAGCGAAAACCATTTCGTC
GGGACCGGCGTGGCCGCGTTCGCGCATGTGCTCGACCACTTCTTCGGCCTCTACGTCCACGCCAACAGCT
TTATCCGGCTGGTGCTCATTTCCAGCGACACAGGGGAGGAACTCGTCCGATGCTTACCGCGAAGCGGCGA
ATCGATCCTGGCATAG