SecReT6
Protein ID: 58583101
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3478
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3729079..3729567 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ5GX39
KEGG IDxoo:XOO3478
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.90E-22, Aligned region: 31..138
Protein Sequence: 162 a.a.     [Download]
>gi|58583101|ref|YP_202117.1| hypothetical protein XOO3478 [Xanthomonas oryzae pv. oryzae KACC 10331]
MKGLEPSLLEKLFDDTPKSTGSSHVFKAISIDQYKESVARDLEGLLNTRSAFSEEGLTEFPNCKQSLLTY
GLGDFSAMSLANGYDRTMICRSLEQAIARHERRLRNVHVTLETAGQFGGGLHFTIHALLDMEPAREPVSF
DAMLQPSTLQYSVSRLRRQAAP
 
Nucleotide Sequence: 489 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3729567-3729079 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGAAGGGACTCGAACCCAGTCTGTTGGAAAAATTGTTCGACGACACGCCCAAGTCCACGGGTAGCTCGC
ATGTGTTCAAGGCCATCTCCATCGACCAATACAAGGAATCGGTCGCTCGCGACCTGGAAGGCCTATTGAA
CACCCGTTCGGCCTTCAGCGAAGAAGGCCTCACCGAATTTCCCAATTGCAAGCAGTCGTTGCTGACCTAC
GGCCTCGGCGATTTTTCCGCGATGAGCCTGGCCAATGGCTACGACCGCACGATGATCTGCCGCTCGCTGG
AGCAGGCGATCGCGCGCCATGAGCGGCGCCTGCGCAACGTGCACGTGACGCTGGAAACCGCCGGCCAGTT
CGGCGGCGGCCTGCATTTCACCATCCATGCGTTGCTGGACATGGAGCCGGCGCGCGAGCCGGTGAGCTTC
GACGCCATGCTGCAACCGTCCACCCTGCAGTACTCGGTCAGCCGCCTGCGGCGCCAGGCAGCGCCCTGA