SecReT6
Protein ID: 58583102
SecReT6 ID83
T6SS typei4b
Gene symbolhcp
Locus tagXOO3479
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3729715..3730212 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ5GX38
KEGG IDxoo:XOO3479
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 5..138
Protein Sequence: 165 a.a.     [Download]
>gi|58583102|ref|YP_202118.1| hypothetical protein XOO3479 [Xanthomonas oryzae pv. oryzae KACC 10331]
MQHAFLSIDTIKGESHDDKHTDWVEIKSFSQDLLQPRSATASTAGGQSAARVNLSPIEIVKSIDLSTTAL
NQACANGTTFPKARIEFMRADKDGNAINYYLVELMNVLVHRVTTTVDEDGMPQEVVQLSFGAIKWTYNQQ
KPEGGVGGKAVAQWSATKNIPNYTV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3730212-3729715 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGCAGCACGCGTTTCTTTCTATCGATACCATCAAGGGTGAATCGCACGACGACAAGCACACGGACTGGG
TGGAGATCAAGTCGTTCTCCCAGGACTTGTTGCAGCCGCGCTCGGCCACCGCATCCACCGCTGGCGGTCA
GTCGGCCGCTCGTGTAAACCTGTCGCCGATCGAGATCGTCAAGTCGATCGATCTGTCCACCACCGCGCTG
AATCAGGCGTGCGCCAACGGCACCACCTTCCCCAAAGCCCGCATCGAGTTCATGCGCGCCGACAAGGACG
GTAATGCCATCAACTACTACCTGGTTGAGTTGATGAACGTGCTGGTACACCGCGTCACCACGACGGTGGA
CGAGGACGGCATGCCGCAAGAAGTCGTCCAGCTGAGCTTCGGCGCGATCAAGTGGACCTACAACCAGCAG
AAGCCGGAAGGCGGAGTCGGCGGCAAGGCGGTTGCGCAGTGGAGTGCTACCAAGAACATTCCCAACTACA
CCGTTTGA