SecReT6
Protein ID: 58583103
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3480
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3730354..3731850 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ5GX37
KEGG IDxoo:XOO3480
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-194, Aligned region: 69..492
Protein Sequence: 498 a.a.     [Download]
>gi|58583103|ref|YP_202119.1| hypothetical protein XOO3480 [Xanthomonas oryzae pv. oryzae KACC 10331]
MAAEVSSATHNSAPAALAETGLLDQIVEQSKVAKSETEHQRAKDIISELAKEVLEGTVVVSDNLNLTLDA
RIAEIDRIISEQLSAVMHAPEFQKLESSWRGLHYMCEQTSTGVTMKIKVFNSPQRDLVRDFKSAIDFDQS
ALFKKVYEEEFGTFGGAPFGALVGDYYIGRQPEDMYFVEQMSHVAAAAHAPFISAASESMFGLETFTDLG
KPRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDAADHSKYLWC
NTAYAMATRLTKAFEDYGWCAAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEIAITDRREKELSDLGF
IPLVHCKNTDYAAFFGAQSAQKPKKYNTDAANANAILSAQLQYMFAVSRIAHYLKAMMREKIGSFASARN
VEDFLNRWISQYVLLDDNAGQEAKAQYPLREASVQVSEVPGKPGVYRAVAFIRPHFQLDELSVSLRLVAE
LPAGTKKA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3731850-3730354 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGCCGCAGAGGTTTCGAGTGCCACCCACAATTCGGCGCCCGCCGCGCTGGCAGAAACAGGCTTGCTCG
ACCAGATCGTCGAGCAGAGCAAGGTCGCCAAATCGGAGACCGAGCACCAGCGTGCGAAGGACATCATCTC
CGAGCTGGCCAAGGAGGTGCTGGAAGGTACCGTCGTGGTGTCGGACAACCTCAATCTGACGCTGGACGCG
CGCATTGCCGAGATCGATCGGATCATCTCTGAGCAGCTGAGCGCGGTGATGCATGCGCCGGAGTTCCAGA
AGCTGGAGAGCAGCTGGCGCGGCCTGCACTACATGTGCGAGCAGACGTCCACCGGCGTGACGATGAAGAT
CAAGGTCTTCAACTCGCCCCAACGGGATCTGGTGCGCGACTTCAAGTCGGCGATCGACTTCGATCAAAGC
GCGCTGTTCAAGAAGGTCTACGAGGAAGAGTTCGGCACCTTCGGCGGTGCGCCATTCGGCGCACTGGTCG
GCGACTACTACATCGGCCGCCAGCCGGAGGACATGTACTTCGTCGAGCAGATGTCGCATGTGGCCGCCGC
GGCGCACGCGCCCTTCATCTCTGCCGCGTCTGAATCGATGTTTGGTCTGGAAACCTTCACCGACCTGGGC
AAACCGCGCGATCTGGCCAAGGTGTTCGACACTGTCGAATACGCCAAGTGGAAGTCGTTCCGTGAGTCGG
AGGATAGCCGCTACGTCGGCCTGACCATGCCGCGTTTTCTCGGGCGGCTGCCGTACAACCCGAAGGACGG
CACTACGGTCGAAGGCTTCAACTTCGTCGAAGACGTCGACGCTGCCGACCATAGCAAGTATCTGTGGTGC
AACACCGCTTATGCGATGGCCACGCGCCTGACCAAGGCGTTCGAGGACTACGGTTGGTGCGCGGCGATCC
GCGGTGTGGAAGGCGGTGGCCTGGTCGAAGACCTGCCGACCCACACCTTCCGCACCGACGACGGCGAAGT
GGCGCTGAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAACTCAGCGACCTGGGCTTC
ATCCCGCTGGTACATTGCAAGAACACCGACTACGCGGCGTTCTTCGGTGCGCAGTCGGCGCAGAAGCCGA
AGAAGTACAACACCGATGCGGCCAATGCCAACGCGATCCTGTCGGCGCAGCTGCAGTACATGTTCGCCGT
GTCGCGTATCGCCCATTACCTCAAGGCGATGATGCGCGAGAAGATCGGCAGTTTCGCCTCGGCGCGTAAT
GTCGAGGACTTCCTGAACCGTTGGATCTCCCAGTACGTGTTGTTGGACGACAACGCCGGTCAGGAAGCAA
AGGCGCAATACCCCTTGCGGGAAGCGTCCGTACAAGTTTCGGAAGTGCCGGGGAAACCCGGTGTCTACCG
CGCGGTGGCCTTCATCAGGCCGCATTTCCAGCTCGATGAGCTGTCTGTTTCGTTGCGTCTGGTGGCCGAA
CTGCCGGCTGGTACCAAGAAGGCGTAG