SecReT6
Protein ID: 58583104
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3481
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3731854..3732354 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ5GX36
KEGG IDxoo:XOO3481
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-58, Aligned region: 11..164
Protein Sequence: 166 a.a.     [Download]
>gi|58583104|ref|YP_202120.1| hypothetical protein XOO3481 [Xanthomonas oryzae pv. oryzae KACC 10331]
MAKKESIQKRLQKIRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEQPLAKVKDRKFVNVDLDNF
DEVMEGMAPRAVYRVPNKISDAGGEFRVELKFKSIDDFRPEAVVDQVEPLRKLLESRTKLADLRNKLAGN
EKLEDLLTDVLNNTEQLKKLGREKEK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3732354-3731854 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGCTAAGAAGGAAAGCATCCAGAAACGTCTGCAGAAGATTCGGCCGCCGCGCGTGCAGCTGACCTACG
ACGTGGAAAAGGGTGACGCGATCGAACAGAAGGAGCTGCCGTTCGTGGTAGGCGTGCTTGGGGATTTCAG
CGGCAATCCCGAACAGCCCCTGGCCAAGGTCAAGGACCGCAAATTCGTCAACGTCGACCTCGACAACTTC
GACGAGGTGATGGAGGGAATGGCGCCGCGCGCGGTTTACCGTGTGCCGAACAAGATCAGCGATGCCGGCG
GCGAGTTCCGCGTCGAACTCAAGTTCAAGTCGATCGACGACTTCCGTCCGGAGGCTGTGGTCGATCAGGT
CGAACCGCTGCGCAAGCTGCTGGAATCGCGCACCAAGCTGGCAGACCTGCGCAACAAGCTGGCCGGCAAC
GAGAAGCTCGAAGACCTGCTAACGGACGTGTTGAACAACACCGAACAGCTGAAGAAGCTGGGTCGGGAAA
AGGAGAAGTAA