SecReT6
Protein ID: 58583106
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3483
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3733231..3733884 [+]
Producttransmembrane protein
NoteTssJ
UniProt IDQ5GX34
KEGG IDxoo:XOO3483
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.10E-31, Aligned region: 33..189
Protein Sequence: 217 a.a.     [Download]
>gi|58583106|ref|YP_202122.1| transmembrane protein [Xanthomonas oryzae pv. oryzae KACC 10331]
MAGCGSSSVRHFRTSMNISAHRFNFLLVLIVAALALSGCASGGIGKAMDKTLQAVGIKEAKPEASPMIPL
RLFAGSNLNAGSDTHATAAVVKIYHLRSAQRFEQAAFNAFLDQAGEQAALGADLLSVNEIVLTPSARQEL
NEQMSEGTTTLGVVGLFRAPAEGRWRMAFDTRRKELPTQGITIGIHACALTTASPALVTRLAGDPSSLAS
VRCAAAR
 
Nucleotide Sequence: 654 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3733231-3733884 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGGCTGGATGTGGATCGTCCTCCGTCCGCCACTTCAGAACAAGCATGAACATATCCGCCCACCGTTTCA
ATTTTCTGTTGGTTCTTATTGTAGCCGCCCTAGCCCTGTCAGGCTGCGCCAGCGGCGGCATCGGCAAGGC
GATGGACAAGACCCTGCAGGCAGTGGGCATCAAGGAAGCAAAGCCAGAGGCGTCTCCGATGATTCCCCTG
CGGCTGTTTGCCGGCAGCAACCTGAATGCGGGCAGCGACACGCACGCCACCGCAGCGGTGGTCAAGATCT
ATCACCTGCGCAGCGCGCAACGCTTCGAGCAGGCCGCGTTCAACGCGTTCCTCGATCAGGCCGGAGAGCA
GGCGGCGCTGGGCGCGGACCTGCTGTCGGTCAACGAGATCGTTCTGACGCCAAGCGCCCGCCAGGAACTG
AACGAGCAGATGTCCGAAGGCACCACCACCCTGGGCGTGGTGGGCTTGTTCCGCGCGCCGGCCGAGGGCC
GCTGGCGCATGGCCTTCGATACGCGACGCAAGGAATTGCCGACCCAGGGCATCACCATCGGCATTCACGC
CTGCGCGCTGACCACCGCCAGCCCGGCGCTGGTCACCCGCCTGGCGGGCGATCCCAGCAGCCTGGCGTCG
GTGCGTTGCGCCGCTGCGCGCTAG