SecReT6
Protein ID: 58583109
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3486
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3736169..3738706 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX31
KEGG IDxoo:XOO3486
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.40E-57, Aligned region: 41..342
Phage_GPD [PF05954], Evalue: 4.40E-57, Aligned region: 620..772
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 233..286
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 580..602
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 667..821
T6SS_Vgr [PF13296], Evalue: 1.60E-30, Aligned region: 515..621
T6SS_Vgr [PF13296], Evalue: 1.60E-30, Aligned region: 698..718
Phage_base_V [PF04717], Evalue: 2.70E-16, Aligned region: 386..495
Protein Sequence: 845 a.a.     [Download]
>gi|58583109|ref|YP_202125.1| hypothetical protein XOO3486 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQVPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGGLPPLEVYVQPRAGRFAQ
EATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVAL
LDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQP
TPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNG
ELAPPFGGGLDARASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTA
RGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTVQALHATLTQQQVPG
LDAHPSVTRLREAIDPQAQGKYTAAVGGQPATKPGDGGRDGQAPVERFAQARLLGESPDHIAWTTPASAV
AYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTA
TDTRIDVLAQHKIVLQAGQTRITLEGGDISFACPGQFTVKASTHPFLGGESGNPQFALPDGLVHLEPDRM
LDFSG
 
Nucleotide Sequence: 2538 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3736169-3738706 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGATATCCCGACGCTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CGTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCGCTGGTGTTCCAGGACCTGGACGCGCGCGCGATTTGCGAACGGATCTTCGCCGACTACCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCGAGGCCGGCGGGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAG
GAAGCGACAGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCG
GGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGG
CCAGCGTTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTG
CTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGC
TGCGCGCGCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGA
CGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCC
ACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCA
CCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAG
CGAAGTGCTGGTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGC
GAGCTCGCCCCACCCTTCGGCGGGGGCCTGGACGCGCGTGCCAGCCACCCCGGCACGCTCAGCGGCCTGC
ACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACTCCCGGCCAGCTGCGCAC
GCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCC
CGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAG
GCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGC
CCAGTTGCACGGCGCCCAACGAACCGTCCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGC
CTGGACGCCCATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAGGCGCAGGGCAAGTACACCG
CTGCGGTCGGCGGCCAGCCGGCGACCAAGCCGGGCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACG
CTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTG
GCCTATGCCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGT
CGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGG
CCCGGTGAGCCTGCAGGCACATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCC
ACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCCGGACAGACCCGCATCACCC
TGGAAGGCGGCGACATCAGCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGGCCAGCACGCATCCGTTCTT
GGGTGGGGAGAGCGGCAACCCCCAATTCGCCTTGCCCGATGGGCTGGTGCATCTGGAACCAGACCGCATG
CTCGATTTCTCGGGCTGA