SecReT6
Protein ID: 58583111
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3488
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3742460..3743893 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX29
KEGG IDxoo:XOO3488
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 2.10E-49, Aligned region: 213..235
DUF2345 [PF10106], Evalue: 2.10E-49, Aligned region: 300..454
T6SS_Vgr [PF13296], Evalue: 6.50E-31, Aligned region: 148..254
T6SS_Vgr [PF13296], Evalue: 6.50E-31, Aligned region: 330..351
Phage_base_V [PF04717], Evalue: 1.50E-16, Aligned region: 19..128
Protein Sequence: 477 a.a.     [Download]
>gi|58583111|ref|YP_202127.1| hypothetical protein XOO3488 [Xanthomonas oryzae pv. oryzae KACC 10331]
MPAATPLRALPQDRSRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQPTPGGLTDSASTAPGHAP
GDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNGEVAPPFGGGLDARAGHP
GTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTARGALRGQGFELASQGWG
NVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTVQALHATLTQQQVPGLDAHPSVTRLREAIDPQ
AQGKYTAAVGGQPATKPGDGGRDGQAPVERFAQARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQL
SAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTATDTRIDVLAQHKIVLQA
GQTRITLEGGDITFACPGQFTVKASMHPFLGGESGSAALPPLPDSLKKPDGTAPFSV
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3742460-3743893 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGCCGGCGGCCACGCCCTTGCGCGCGCTGCCGCAGGACCGCTCGCGCATGCCCGGGCCGCAGAGCGCGC
GCGTGGTCGGCGTGGCCGACGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTG
GCAGCGCGGCGACCAGCCCACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCG
GGCGACCAGCGCGCCGGCACCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACT
TCCTGCCGCGCATCGGCAGCGAAGTGCTGGTGGAGTTCCTGCACGGAGACATCGATCAGCCGCGCATCAC
CGGCCAGTTGTACAACGGCGAGGTCGCCCCACCCTTCGGCGGCGGCCTGGACGCGCGTGCCGGCCACCCC
GGCACGCTCAGCGGCCTGCACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACA
CCCCCGGCCAGCTGCGCACGCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGT
CCAGCACAGCGACACCGCCCGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGC
AACGTGCATGCCGCGCAAGGCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGG
ACGTGGCCGAGGCGGTGGCCCAGTTGCACGGCGCCCAACGCACCGTCCAGGCGCTGCACGCCACCCTGAC
CCAGCAACAGGTGCCCGGCCTGGACGCCCATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAG
GCGCAGGGCAAGTACACCGCTGCGGTCGGCGGCCAGCCGGCGACCAAGCCGGGCGACGGCGGCCGCGACG
GCCAGGCACCGGTGGAACGCTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGAC
CACCCCGGCCAGCGCGGTGGCCTATGCCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTG
AGCGCCGGGCAGACCCTGTCGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGGCCGATCA
AACTCATCGCCGCCGCCGGCCCGGTGAGCCTGCAGGCACATACCGGCGCGCTGGAACTGCTGGCCGACCA
GGCGGTGACCGTCACCGCCACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCC
GGACAGACCCGCATCACCCTGGAAGGCGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGG
CCAGCATGCATCCGTTCTTGGGTGGGGAGAGCGGCAGTGCCGCCCTGCCGCCTTTGCCTGACAGCTTGAA
GAAGCCCGATGGCACTGCACCTTTCTCCGTCTAA