SecReT6
Protein ID: 58583113
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3490
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3746714..3748975 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX27
KEGG IDxoo:XOO3490
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 38..89
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 391..424
DUF2345 [PF10106], Evalue: 6.80E-49, Aligned region: 478..630
T6SS_Vgr [PF13296], Evalue: 1.90E-30, Aligned region: 33..69
T6SS_Vgr [PF13296], Evalue: 1.90E-30, Aligned region: 326..432
T6SS_Vgr [PF13296], Evalue: 1.90E-30, Aligned region: 509..529
Phage_base_V [PF04717], Evalue: 6.70E-17, Aligned region: 129..173
Phage_base_V [PF04717], Evalue: 6.70E-17, Aligned region: 197..306
Phage_GPD [PF05954], Evalue: 1.20E-15, Aligned region: 4..149
Phage_GPD [PF05954], Evalue: 1.20E-15, Aligned region: 429..583
Phage_GPD [PF05954], Evalue: 1.20E-15, Aligned region: 596..623
Protein Sequence: 753 a.a.     [Download]
>gi|58583113|ref|YP_202129.1| hypothetical protein XOO3490 [Xanthomonas oryzae pv. oryzae KACC 10331]
MSATLVIFDPQAQVPDSGTIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAQAE
AGALPPLEVYVQPRAGRFAQEATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQHF
VPVAIEHVAVKQPGPRASSPFWTRRSWSTAATATVSWRCRAATPLRTLPQDRPRMPGPQSARVVGVADAA
LSPSRDHQVRIQFPWQRGDQPTPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEV
LVEFLHGDIDQPRITGQLYNGELAPPFGGGLDAHASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRL
HTSLADTRLELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQL
HGAQRTAQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQAATTPADGGRDGQAPVERFA
QARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPV
SLQAHTGALELLADQAVTVTATDTRIDVLAQHKIVLQAGQTRITLEGGDITFACPGQFTVKASMHPFLGG
EMNAVAIPPLPEERLPLQTLSLDHRYHDDQGLAGADYVVTLADGGKRHGTLDAQGRAEVANVPGGSAEVV
FSPMPGLFGRKDMTPTPDHAANPADAKLDGVVDKYLAAATADSVKADPVKGVQ
 
Nucleotide Sequence: 2262 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3746714-3748975 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGTCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGCACGATCCGCTTCCACC
GCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCGGCGTCGTGCCCACCGC
CAGCACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGCCCAGGCCCAGGCCGAG
GCCGGCGCGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAGGAGGCGACCG
CGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCGGGGCCGGCAG
CGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGGCCAGCATTTC
GTTCCGGTGGCGATCGAGCACGTGGCGGTGAAACAACCTGGGCCAAGGGCATCGTCCCCCTTCTGGACCC
GCCGGAGCTGGAGCACGGCAGCTACCGCAACCGTTTCCTGGCGGTGCCGGGCGGCCACGCCGCTGCGCAC
GCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGACGCGGCG
CTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCCACCCCGG
GCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCACCTGGGT
GCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAGCGAAGTG
CTGGTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGCGAGCTCG
CCCCACCCTTCGGCGGCGGCCTGGACGCGCATGCCAGCCACCCCGGCACGCTCAGCGGCCTGCACACCCA
GTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCACGCGCCTG
CACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCCCGCGGCG
CGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAGGCCTGCT
GCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGCCCAGTTG
CACGGCGCCCAACGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGCCTGGACG
CCCATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAAGCGCAGGGCAAGTACACCGCTGCGGT
CGGCGGCCAGGCAGCGACCACGCCGGCCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACGCTTCGCC
CAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTGGCCTATG
CCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGTCGGCGGT
GTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGGCCCGGTG
AGCCTGCAGGCGCATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCCACCGACA
CCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCCGGACAGACCCGCATCACCCTGGAAGG
CGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGGCCAGCATGCATCCGTTCTTGGGTGGG
GAGATGAATGCCGTCGCCATCCCCCCGCTGCCGGAAGAACGCCTTCCCCTGCAAACGCTGTCGCTCGATC
ATCGCTACCACGACGATCAGGGCCTGGCCGGTGCCGACTACGTGGTCACCCTGGCCGATGGCGGCAAACG
GCACGGCACGCTCGACGCGCAGGGACGCGCCGAGGTGGCGAATGTCCCCGGCGGCTCGGCCGAGGTGGTG
TTCTCGCCGATGCCGGGCCTGTTCGGCCGCAAGGACATGACGCCCACGCCCGATCACGCGGCCAATCCTG
CCGACGCAAAGCTGGACGGCGTGGTGGACAAGTATCTGGCCGCCGCCACCGCCGATTCCGTTAAAGCCGA
TCCCGTTAAAGGAGTGCAGTGA