SecReT6
Protein ID: 58583117
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3494
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3755428..3756219 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ5GX23
KEGG IDxoo:XOO3494
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.40E-57, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|58583117|ref|YP_202133.1| hypothetical protein XOO3494 [Xanthomonas oryzae pv. oryzae KACC 10331]
MMNPLPPTPGPMPSLTAQAPHGLASAHPSTPQSLLDLMADGFYLLLLLKRAQMPSDTESFVQSVQTFLDG
VERGAVKLGIASEDIYAAKYAFCAAVDEAILSQPSALHETWERNPLQLRLFGEHLAGEHFFDRLEELRRQ
GAVRLPSLEIYHYCLLLGFEGKYRLEGPEKLGYLTARLGDEIIYFKGKRSGFAPHWPPPDNVRHALRRVV
PLWLPAALVTGFGLLGFFGLRLSLDHQTEQRMAAYNQVVQMPQRTAHITITLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3755428-3756219 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGATGAACCCGCTGCCCCCCACCCCCGGCCCGATGCCGTCGCTGACCGCGCAGGCGCCGCACGGCCTGG
CCAGCGCCCATCCCTCCACGCCGCAGAGCCTGCTCGACCTGATGGCCGACGGCTTCTACCTGTTGCTGCT
GCTCAAGCGCGCGCAGATGCCCAGCGACACCGAATCCTTCGTGCAGTCGGTGCAGACATTCCTCGATGGC
GTGGAACGCGGCGCAGTCAAGCTCGGCATCGCCTCCGAGGACATCTACGCGGCCAAATACGCGTTCTGCG
CGGCAGTGGACGAAGCGATCCTGTCGCAGCCCTCGGCACTGCACGAAACCTGGGAACGCAATCCGCTGCA
GCTGCGCCTGTTCGGCGAACACCTGGCCGGCGAGCATTTCTTCGATCGCCTGGAAGAGCTGCGCCGCCAG
GGCGCCGTGCGCCTGCCCTCGCTGGAGATCTACCACTATTGCCTGCTGCTTGGCTTCGAAGGCAAGTATC
GGCTGGAAGGGCCGGAGAAGCTCGGCTACCTGACCGCGCGGCTGGGCGACGAGATCATCTATTTCAAGGG
CAAGCGCAGCGGTTTCGCACCGCATTGGCCGCCGCCGGACAACGTGCGCCATGCCTTGCGCCGTGTGGTA
CCGCTGTGGCTGCCGGCCGCGCTGGTGACCGGCTTCGGCCTGCTCGGCTTCTTCGGTCTGCGCCTGTCTC
TGGACCACCAGACCGAGCAGCGCATGGCCGCCTACAACCAGGTGGTGCAGATGCCGCAACGCACCGCGCA
CATTACGATCACTCTGCCGTGA