SecReT6
Protein ID: 58583118
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3495
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3756230..3757396 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX22
KEGG IDxoo:XOO3495
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-58, Aligned region: 41..342
Protein Sequence: 388 a.a.     [Download]
>gi|58583118|ref|YP_202134.1| hypothetical protein XOO3495 [Xanthomonas oryzae pv. oryzae KACC 10331]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQAPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGALPPLEVYVQPRAGRFAQ
EATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVAL
LDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQ
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3756230-3757396 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGGATATCCCGACGCTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CGTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCGCTGGTGTTCCAGGACCTGGACGCGCGCGCGATCTGCGAACGGATCTTCGCCGACTATCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGCGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCGAGGCCGGCGCGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAG
GAGGCGACCGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCG
GGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGG
CCAGCGTTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTG
CTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGC
TGCGCGCACTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGTAG