SecReT6
Protein ID: 58583126
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3503
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3763083..3764609 [-]
ProductVGR-related protein
NoteTssI
UniProt IDQ5GX14
KEGG IDxoo:XOO3503
PDB IDNA
Domain hit(s) vs Pfam T6SS_Vgr [PF13296], Evalue: 4.30E-35, Aligned region: 306..412
Phage_base_V [PF04717], Evalue: 7.50E-25, Aligned region: 149..246
Phage_GPD [PF05954], Evalue: 5.10E-08, Aligned region: 11..77
Phage_GPD [PF05954], Evalue: 5.10E-08, Aligned region: 132..189
Protein Sequence: 508 a.a.     [Download]
>gi|58583126|ref|YP_202142.1| VGR-related protein [Xanthomonas oryzae pv. oryzae KACC 10331]
MYELVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQAPQQGQAPPAQLLLTRV
WHAGINNLPVDVRAAVQSQLGVAPAWPDTSAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGAR
LHPRPTAPGYQSAIVVGADGSTDGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGVGS
QFLPRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYAKAGDGRPSAQGNLAGG
HAPAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFDDSDQQLRLQLATTQAATQLNLGHLIHQADN
YRGSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTLGKTFSQAAGTHQTVKL
AAHEGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADAKGAAAERRASPGDDRVPHTGDALLGLAAPA
GIGVVAGQGLAPGAWARR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3764609-3763083 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGTACGAGCTGGTGGGGATGGACGCCTTCGCCAGCGCGCAGGCAGCAGACCGCTCTGCGGAGTTGATGG
CGCAGGCGCACGAGGCACAGTGGTCACCGTGGCAGGGCCGCAGCACGGTGCGCACGCTGCGCGCCGGCAC
CTGGTTCACGCTGACCCAGGCACCGCAGCAGGGCCAGGCGCCGCCGGCGCAGCTGTTGCTGACGCGGGTG
TGGCATGCGGGTATCAACAACTTGCCGGTGGACGTGCGCGCGGCGGTGCAGTCGCAGTTGGGGGTCGCGC
CGGCGTGGCCGGACACCAGCGCGGTGGCCGCACGCAGCACCTGGGCGCAGGCCGAGGCGGTGGGCTACGG
CAACGCCTTCGAGGCGGTGGACCGGCAGCAGCCGTGGCGGCCGGTGCTGGCCGACGGCACCGGTGCGCGG
CTGCACCCGCGGCCGACCGCGCCGGGCTACCAGAGCGCCATCGTGGTCGGTGCCGATGGCAGCACCGACG
GCAGCCAGGAGGTCCATGCCGACGCGCTGGGCCGGATCCGGGTCAGGTTCCACTTCCAGCACGCCGCGTC
GGCCCCGGCGGCGCAGGACAGCACGTGGCTGCGGGTGGCGCAGCGCTACGCCGGCCCGGGCGTGGGCAGC
CAGTTCCTGCCACGCATCGGCCAGGAAGTGCTGGTGGGCTTCCTGGAGGGGGACATCGACCGTCCGGTGG
TGCTGGGGGCGCTGTACAACGGCAAGGGCGAAGCCGGCGTTCCCGCCACCCCCGGCGGCACCAGCGCCGA
GGCCGACACCGGCCTGTACGCCAAGGCCGGCGACGGCAGACCCAGCGCGCAGGGCAACCTGGCCGGCGGC
CATGCCCCGGCCTGGCACGGCGCCGGCGGCGGCGCGGACAACCACCGCAACGCCACCGCGCTGTGGGGCG
TGCAATCCAAGGAATGGGGCGGCGCTGGCCACAGCCGGCTGGTGTTCGACGACAGCGACCAGCAATTGCG
CTTGCAACTTGCGACCACCCAGGCAGCCACGCAACTGAACCTGGGGCACCTGATCCACCAGGCCGACAAC
TACCGCGGCAGCTTCCGCGGGGAAGGCTTCGAACTGCGCACCGACGCGTGGGGCGCGGTGCGGGCCAGCT
CGGGGCTATGGCTGAGCAGCTACGGCCGCAGCGGCGGCCCGGCCGGCGAGGCGACCCAGCCCAGCGCATT
GCTGAGCCAGCTGCAGACGCTGGGCAAGACGTTCTCGCAGGCGGCGGGCACGCACCAGACGGTGAAGCTG
GCCGCGCACGAAGGCGTGGGCCAGGCGAACCACTCCCAGCTGATCGCCGAGCAGGCGCCGCTGCCGGCGC
TGCTGACCAGCGTGAAGACCACGGTGCCGGGCACGGCCTACGCCGACGCCAAGGGCGCGGCGGCCGAGCG
CCGCGCCAGCCCGGGCGACGACCGGGTGCCGCACACCGGCGATGCGCTGCTGGGCCTGGCGGCGCCAGCG
GGGATCGGCGTGGTGGCCGGCCAGGGCCTGGCGCCTGGAGCGTGGGCGAGACGCTGA