SecReT6
Protein ID: 58583127
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3504
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3764610..3765293 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ5GX13
KEGG IDxoo:XOO3504
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-24, Aligned region: 80..213
YiaAB [PF05360], Evalue: 3.30E-05, Aligned region: 20..40
YiaAB [PF05360], Evalue: 3.30E-05, Aligned region: 59..81
Protein Sequence: 227 a.a.     [Download]
>gi|58583127|ref|YP_202143.1| hypothetical protein XOO3504 [Xanthomonas oryzae pv. oryzae KACC 10331]
MIMRTRIANHSSVAFVGALWVGLLLFGVFAAVSVQKSVRDRVDGIGVTAIHHGEAGCSVVAALSLLTVGL
CNATPPLSAKIVEAVFADYAPMASWQWSEETSAFLGQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQE
AAPSPGGHQLVVFADSAAQPQDPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGRLTVLSEDFKTRQ
ARSAQLPLHGGGRQSLR
 
Nucleotide Sequence: 684 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3765293-3764610 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
GTGATCATGCGAACGCGTATTGCCAACCATTCGTCCGTGGCCTTCGTCGGCGCGTTGTGGGTGGGGCTGC
TGCTGTTCGGCGTATTCGCGGCGGTATCGGTACAGAAGAGCGTGCGCGATCGCGTCGACGGCATCGGCGT
GACGGCGATCCACCATGGAGAGGCCGGGTGTTCGGTCGTCGCCGCGCTGTCGCTGCTGACCGTCGGTCTG
TGCAACGCGACGCCGCCTCTGAGCGCAAAAATCGTGGAAGCGGTGTTCGCCGACTACGCGCCGATGGCAA
GCTGGCAGTGGAGCGAGGAGACGAGCGCGTTCCTGGGGCAGGCGCGGCCGCGCAGCTACTGCGTGCAGTA
CCGCGAGAGCGACCTGGATTTCGTGCAGCGGCTGCTGGCCGAGGAAGGCCTGGGCTGGAGGCTGCAGGAG
GCGGCCCCGTCGCCCGGCGGGCACCAGCTGGTGGTGTTCGCCGACAGCGCCGCGCAACCGCAGGACCCCA
GTTCGGCGCAGGGCGGCGGGCTGCGCTACCACCGCAGCGACGCCACCGAGGCGGCCGACAGCGTGCTGGC
GATCGGCGCCACCCGGCGGCTGGGCAGCGGCCGGCTGACGGTGCTCAGCGAAGACTTCAAGACGCGCCAG
GCGCGCAGCGCGCAGTTGCCGTTGCACGGCGGCGGCAGGCAGTCGCTGCGCTAG