SecReT6
Protein ID: 58583137
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3514
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3778907..3779968 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ5GX03
KEGG IDxoo:XOO3514
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.60E-25, Aligned region: 54..113
Protein Sequence: 353 a.a.     [Download]
>gi|58583137|ref|YP_202153.1| hypothetical protein XOO3514 [Xanthomonas oryzae pv. oryzae KACC 10331]
MLDLDALLAPISDHQPAGEDLSFSIEFDRIQEARRSDDPTLDQGEWQTDIKYADWSSVARQCGDLLQTRT
KDLRLAGWMTEATTQIDGFAGLALGYRLIAGLCDRYWDEVHPLVVDGDHEERIGNLSWLLTNSLHWLRAV
PIASGPQGRFGLNAFEAAHTRSANAGSGDDEGQPSLDLLEAVRRDTPHDFYRQLVDALLNCAEALQSLQA
AVDDRLGIDGPSFSAVREQVEHLQRTVARFARDAGLLLDGEAEAGPHDMPGIGFGPAANKDAPPAPREPG
GAPTTRKEALAQLRQVAEFFRRTEPHSPVAYLAEKAARWGEMPLHVWLKRVIKDGSVLNQMEEMLDVNQN
LEQ
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|58579623|ref|NC_006834.1|:3778907-3779968 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGCTGGATCTGGATGCCCTGCTGGCGCCGATTTCCGACCATCAGCCGGCCGGCGAAGACCTGTCTTTCT
CCATCGAGTTCGATCGCATCCAGGAAGCCAGACGCTCGGACGATCCGACCCTGGACCAGGGCGAGTGGCA
GACCGATATCAAGTATGCGGACTGGTCCAGCGTCGCCCGCCAGTGCGGCGATCTGCTGCAGACGCGTACC
AAGGACCTACGCCTGGCCGGCTGGATGACCGAGGCGACCACCCAGATCGACGGCTTCGCCGGGCTGGCGC
TGGGTTACCGGCTGATCGCCGGGCTATGCGACCGGTACTGGGACGAGGTGCACCCGCTGGTCGTCGATGG
CGACCACGAAGAGCGCATCGGCAACCTGAGCTGGCTGCTGACCAATTCGCTGCATTGGTTGCGCGCGGTG
CCGATCGCCTCGGGACCGCAGGGCCGTTTCGGTCTCAACGCTTTCGAGGCCGCGCATACCCGCAGCGCCA
ATGCCGGATCCGGCGACGACGAAGGCCAGCCCAGCCTGGACCTGCTCGAGGCCGTACGGCGCGATACGCC
TCACGATTTCTACCGGCAGTTGGTCGATGCGCTACTCAATTGCGCCGAAGCGCTGCAGTCGCTACAGGCG
GCGGTGGACGATCGCCTAGGCATCGACGGACCCAGCTTCAGCGCGGTGCGCGAGCAGGTGGAACACCTGC
AGCGCACCGTGGCGCGGTTCGCCCGCGATGCTGGGCTACTGCTGGATGGCGAGGCCGAAGCCGGCCCGCA
CGACATGCCGGGCATCGGGTTCGGCCCGGCCGCGAACAAGGACGCGCCGCCGGCGCCACGCGAGCCGGGC
GGCGCACCGACCACCCGCAAGGAAGCGTTGGCGCAGCTGCGTCAGGTCGCCGAATTCTTCCGGCGTACCG
AACCGCACAGCCCCGTCGCCTACTTGGCCGAAAAAGCCGCGCGCTGGGGCGAGATGCCGCTGCACGTGTG
GTTGAAGCGGGTTATCAAAGACGGCAGCGTCCTCAACCAGATGGAAGAGATGCTGGACGTCAACCAGAAC
CTGGAGCAGTAG