SecReT6
Protein ID: 59711601
SecReT6 ID84
T6SS typei1
Gene symbol-
Locus tagVF_0994
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1096135..1096968 [-]
ProductOmpA family protein
NoteTssL
UniProt IDQ5E657
KEGG IDvfi:VF_0994
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-65, Aligned region: 57..261
Protein Sequence: 277 a.a.     [Download]
>gi|59711601|ref|YP_204377.1| OmpA family protein [Vibrio fischeri ES114]
MNSSSMDDRTVLITQEPNQVNPTLTESPSAPKFNQLQERMVYAARIKPEEYNFAGNNPLISAASSLLCIT
CDLKKESYQDIELLKPKLVEELKSFEFQAINSGVESNYVALSRYLLCTFVDEIIVTTPWGSESHWASKSM
LSSFHNETYGGEKFFLLLEKLSRNPAKYLDLLELMYLCLSLGFEGKYRVLSRGLVELDAIRDSLYRQIRS
LRGDEQASLSPNWEPKQVQRHKLTRQTSWVGIVCVVVFSLCAIYGGFYYVLDQQSEHVIQAFQQIDL
 
Nucleotide Sequence: 834 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1096968-1096135 Vibrio fischeri ES114 chromosome I, complete sequence
ATGAACAGCAGCAGCATGGATGACCGTACTGTACTTATCACACAAGAGCCTAATCAAGTTAACCCAACTT
TAACTGAAAGCCCAAGTGCACCCAAATTCAACCAGCTTCAAGAGCGCATGGTCTACGCCGCGCGTATTAA
ACCAGAAGAATACAATTTTGCAGGAAACAACCCACTAATCAGTGCTGCTTCCTCATTACTCTGTATCACG
TGTGACTTAAAAAAAGAAAGCTACCAAGATATTGAGTTACTAAAACCTAAATTAGTTGAAGAGTTAAAAT
CCTTCGAGTTTCAAGCCATTAACTCAGGTGTTGAGAGTAATTATGTTGCCTTATCTCGCTACCTGCTTTG
CACTTTCGTTGATGAAATCATCGTAACAACGCCATGGGGTTCAGAAAGTCACTGGGCCTCAAAAAGCATG
TTAAGTAGCTTTCATAACGAAACATATGGTGGTGAGAAATTTTTCTTACTATTAGAAAAACTCAGTAGAA
ACCCTGCTAAGTATTTAGATCTATTAGAGCTAATGTACCTATGTTTGAGCTTAGGTTTTGAAGGTAAATA
TCGAGTGTTATCAAGAGGTCTAGTCGAATTAGACGCCATTCGTGATTCTCTTTATCGCCAAATTCGCTCT
TTACGAGGAGATGAGCAAGCTAGCCTCTCTCCAAACTGGGAACCGAAACAAGTTCAACGCCATAAACTCA
CAAGACAAACCTCTTGGGTTGGCATTGTATGCGTTGTGGTTTTCTCATTGTGTGCTATTTACGGTGGTTT
CTATTATGTATTGGACCAACAATCAGAGCATGTAATTCAAGCTTTTCAGCAAATTGATTTATAG