SecReT6
Protein ID: 59711602
SecReT6 ID84
T6SS typei1
Gene symbol-
Locus tagVF_0995
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1096970..1098292 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ5E656
KEGG IDvfi:VF_0995
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-129, Aligned region: 16..438
Protein Sequence: 440 a.a.     [Download]
>gi|59711602|ref|YP_204378.1| hypothetical protein VF_0995 [Vibrio fischeri ES114]
MQKVIWKEGMLLRPQHFQQSDRYYQNQLQVRTQKQHRFNWGFHSLSFDNHHLSVGKIVISQASGILPDGS
LFDIQHQTTPIVWESDAPKTNLNLYLAISLSTINSPEARDEKETEINTRYVSHDLTISDNNAQVQNLQTI
SCGELDFHIITEEEIDNHWVKIKLCEIKQVTPEGAIQLNPNFEASFINGVHSSLVHRSLREVLTLVTHKA
DILAERITKSGHATSEIGDFLLLQLLNKYEPQLHYLNKCSQYHPEELFLLLSSLQGELSTYDSGHRRPDL
KLSYNHKEQGESFDQILFHLRKQLNQSLKQNAFEIPLQKRNHGVLIAPISDDSLLQEATFILAARSHTDA
ESLRKQLPPQLKVGPVEKIRNLVNLQLPGITCRSLSVAPRQVPFHGDYCYFTLDLTSNDRSQLTQSGGFA
FHIAGDFPELSLFFWAIRNS
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1098292-1096970 Vibrio fischeri ES114 chromosome I, complete sequence
ATGCAAAAAGTTATATGGAAAGAAGGCATGCTATTGCGGCCTCAACATTTCCAACAAAGTGATCGTTACT
ATCAAAATCAACTGCAAGTACGCACGCAGAAGCAACACAGGTTTAATTGGGGTTTCCATTCTCTGAGCTT
TGATAATCATCATTTATCTGTTGGAAAGATAGTGATCAGTCAAGCTAGTGGTATTTTACCCGATGGTTCA
CTATTTGATATTCAACATCAAACAACCCCTATTGTTTGGGAGTCTGATGCGCCTAAAACAAACTTAAATC
TGTATTTAGCGATTTCTTTATCGACTATCAATAGTCCGGAAGCTCGCGATGAAAAAGAAACCGAAATTAA
CACTCGTTATGTTTCTCACGATTTAACCATTTCAGATAATAATGCCCAAGTACAAAACTTGCAGACTATC
AGTTGTGGTGAGTTAGATTTTCATATTATTACCGAAGAAGAGATTGATAATCATTGGGTTAAAATCAAAC
TATGTGAAATTAAACAAGTCACTCCAGAAGGTGCGATCCAACTCAACCCTAATTTTGAAGCGAGTTTTAT
CAATGGTGTTCACTCGTCTCTTGTTCATCGTTCGCTACGAGAAGTCTTAACTCTCGTTACTCATAAAGCC
GATATTTTAGCCGAACGTATTACCAAATCAGGACACGCAACCTCAGAAATTGGTGACTTCTTATTGCTTC
AATTATTAAATAAGTACGAGCCTCAACTCCACTATCTAAATAAGTGCTCTCAATACCATCCGGAGGAGCT
CTTTTTATTACTTTCATCTTTGCAAGGAGAGTTGTCTACTTATGATTCAGGTCATCGTCGACCAGATCTA
AAATTATCATACAATCATAAAGAACAAGGCGAGTCATTTGATCAGATCTTATTTCATTTGCGTAAACAGC
TGAATCAGTCATTGAAACAAAACGCCTTTGAGATACCACTACAAAAACGCAATCACGGTGTACTTATTGC
CCCTATTTCTGATGATAGCTTATTGCAAGAAGCCACCTTTATTCTCGCGGCTCGCTCTCATACCGACGCT
GAAAGCTTACGAAAACAACTGCCACCACAATTAAAAGTCGGACCTGTTGAAAAAATTCGCAACCTTGTAA
ACCTTCAATTACCGGGGATCACTTGTCGCTCACTTTCTGTAGCCCCAAGACAAGTCCCTTTCCATGGTGA
TTATTGTTATTTCACCCTTGATTTAACCTCAAACGATCGCTCTCAACTAACGCAATCTGGAGGATTTGCC
TTCCATATTGCAGGTGATTTCCCTGAGCTTTCTCTTTTCTTTTGGGCAATAAGGAATAGTTAA