SecReT6
Protein ID: 59711603
SecReT6 ID84
T6SS typei1
Gene symbol-
Locus tagVF_0996
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1098304..1098795 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ5E655
KEGG IDvfi:VF_0996
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.70E-39, Aligned region: 10..142
Protein Sequence: 163 a.a.     [Download]
>gi|59711603|ref|YP_204379.1| lipoprotein [Vibrio fischeri ES114]
MKKLFTFIALLLLIGCSSTPDPTYVALTLNASANVNPDHADRPSPLVVRVLELSSITGFENSEFFDLYNN
AKSTLGADFIAEEEIILRPGDKKIIKLKLSEKGQYLAVIGAYQDIDNAKWHYIYTVEPEEAQKVELIATD
SSIVKLKRVKKKKNAPQSSNARI
 
Nucleotide Sequence: 492 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1098795-1098304 Vibrio fischeri ES114 chromosome I, complete sequence
ATGAAAAAATTATTTACCTTCATAGCTCTATTATTACTCATTGGATGCAGCAGCACACCAGATCCAACTT
ACGTAGCGCTTACTCTCAATGCCTCTGCAAATGTTAACCCTGATCATGCGGATCGCCCCTCGCCTCTAGT
GGTAAGGGTATTAGAGTTATCTTCAATTACTGGCTTTGAAAACTCAGAATTTTTTGATTTATACAATAAT
GCAAAATCAACCTTAGGAGCGGATTTTATCGCAGAAGAGGAAATCATCTTACGACCGGGCGATAAGAAAA
TCATCAAATTAAAGCTCAGTGAAAAAGGACAATATTTAGCCGTTATCGGCGCTTATCAAGATATAGATAA
TGCAAAATGGCATTACATATACACAGTTGAGCCCGAAGAGGCACAAAAAGTGGAATTGATCGCTACCGAC
TCTTCTATCGTCAAATTAAAACGCGTGAAAAAGAAAAAGAACGCACCACAAAGCAGTAATGCGCGAATTT
AG