SecReT6
Protein ID: 59711604
SecReT6 ID84
T6SS typei1
Gene symbol-
Locus tagVF_0997
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1098832..1100142 [-]
Productphospho-specific protein-protein interaction motif-containing protein
NoteFha
UniProt IDQ5E654
KEGG IDvfi:VF_0997
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.50E-15, Aligned region: 29..97
FHA [PF00498], Evalue: 3.50E-15, Aligned region: 266..293
FHA [PF00498], Evalue: 3.50E-15, Aligned region: 398..409
DUF1943 [PF09172], Evalue: 0.0087, Aligned region: 190..288
Protein Sequence: 436 a.a.     [Download]
>gi|59711604|ref|YP_204380.1| phospho-specific protein-protein interaction motif-containing protein [Vibrio fischeri ES114]
MELAFDIIQSQDLPIDTLPTFTFKKAGGTIGRSPNADWYIADSKRQLSNVHASISFEDEQFFITDSSTNG
TYLNGDEASLNSGELHPISHGDVYELGFIKIRARLLQDPTHYRSPETNPNASRDPLSNHGTDESPSVFDM
IPDDSFLSDGPIEELLNSDEEIILKQVEESTPSHTQMDDVLLKEQFISPIFNEEELSNDSLDDEIELEPT
YQPKKSEEKINTTSKNKIDSITNKEVRNTQTTSNEAYLAALSKGLGIELTNLEDPEQTLFDIGSALRSSV
NGIQQLLRTRTEIKNKLTANATTIQGQGNNPIKFTHDVNDALNIIIHHKPGYLQGIEAINQSCKDIQANQ
LAIHDACQHTLDALIEKLSPETLIYRFVQEGIQSKFGKPDAKYWQAYSKLHKQISKDPDWRNALLEQDFA
KQYESQLQMLTAALRV
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1100142-1098832 Vibrio fischeri ES114 chromosome I, complete sequence
ATGGAACTGGCTTTTGATATTATTCAATCACAAGATTTACCTATTGATACCTTACCTACTTTTACCTTCA
AAAAAGCGGGTGGCACCATTGGTCGCAGTCCAAATGCCGATTGGTATATTGCAGATAGTAAAAGACAATT
ATCAAACGTCCATGCTTCGATTAGCTTTGAAGACGAACAGTTTTTCATTACCGATAGCAGTACCAATGGC
ACGTATTTAAACGGAGATGAAGCATCATTAAATAGTGGTGAACTGCATCCGATATCACATGGCGATGTAT
ACGAGTTGGGATTTATTAAAATACGCGCTCGTCTATTACAAGACCCAACACATTATCGTTCACCAGAAAC
AAATCCAAATGCCTCTCGTGATCCTTTATCAAACCATGGTACGGATGAGTCACCATCGGTATTTGATATG
ATCCCTGATGATAGTTTTTTAAGTGATGGACCAATTGAAGAACTATTAAATTCAGATGAAGAAATCATTC
TAAAACAAGTAGAAGAATCGACACCTTCTCACACACAAATGGATGATGTGCTACTTAAAGAGCAATTCAT
TTCTCCGATATTTAATGAAGAGGAACTTAGCAATGATTCCCTTGATGATGAGATTGAACTAGAACCAACT
TATCAACCAAAAAAATCAGAGGAAAAGATCAATACGACCTCTAAAAATAAAATAGATAGCATCACAAACA
AAGAAGTGCGTAATACACAAACAACCTCAAACGAAGCTTATTTAGCTGCATTATCTAAAGGATTAGGCAT
CGAGCTAACTAACCTCGAAGACCCAGAACAAACCTTATTTGATATTGGCTCTGCGCTTCGCAGTTCAGTA
AATGGCATCCAACAATTACTACGTACACGTACTGAAATCAAAAATAAATTAACAGCGAATGCCACCACGA
TTCAAGGCCAAGGTAATAACCCAATAAAATTCACCCATGATGTTAACGATGCACTCAATATCATTATTCA
TCATAAACCTGGGTATCTACAAGGGATTGAAGCCATCAACCAAAGCTGCAAAGACATCCAAGCGAATCAA
TTGGCTATTCATGACGCTTGCCAACATACGTTAGATGCATTGATTGAAAAACTCTCTCCAGAAACGCTGA
TATATCGTTTTGTACAAGAAGGAATACAAAGCAAATTTGGCAAACCTGACGCCAAATATTGGCAGGCTTA
CAGCAAACTACACAAACAAATCAGCAAGGACCCTGACTGGCGCAACGCACTATTAGAGCAAGATTTTGCT
AAACAATATGAATCTCAATTACAAATGCTCACAGCAGCACTTCGTGTGTAA