SecReT6
Protein ID: 59711607
SecReT6 ID84
T6SS typei1
Gene symbol-
Locus tagVF_1000
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1104430..1105470 [-]
Productquinoprotein dehydrogenase
NoteTssG
UniProt IDQ5E651
KEGG IDvfi:VF_1000
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-84, Aligned region: 31..332
Protein Sequence: 346 a.a.     [Download]
>gi|59711607|ref|YP_204383.1| quinoprotein dehydrogenase [Vibrio fischeri ES114]
MATTNGATTSNLVSITSNQIPIQLGITIEHIGHLSLMKALDHVCHHLKTKHDDWDLDQAYDRIQFVANPS
QGFAPREIQSIKVITHDDGLPKVIMTLNMLSLIGASSPLPAFYNDYLLQDENNVLKSFLDIFHHRLHRLI
RSVWQKYRYNAAFREGANDPFSQYIFALLGLKNPELRDDDSINWSRLFPYLGLLSQRVRSANTIEALLRY
YFQHSAIHIEECILRHCSIPTQQLCELGQNNAVLSSSSVLGSSAPDRANKFRIHIKELTWDHFHSFLTDK
PNWIALNQLVQFTVKDPLDFDIQLHLKKDEPRPLTLSVDNECCLGWTSWLGSNPNEGRITLSGKTL
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1105470-1104430 Vibrio fischeri ES114 chromosome I, complete sequence
ATGGCTACCACGAATGGGGCAACAACCTCTAATTTAGTCTCGATAACATCAAATCAAATTCCTATTCAAT
TAGGAATAACCATTGAACATATTGGACATTTATCCTTGATGAAGGCATTGGATCATGTATGTCATCACTT
AAAAACCAAACATGATGACTGGGATCTTGATCAGGCCTATGACCGCATTCAATTTGTAGCGAATCCTTCA
CAAGGTTTTGCTCCTCGTGAGATTCAAAGCATTAAAGTAATTACTCATGATGATGGGCTACCAAAAGTCA
TTATGACGTTAAATATGCTGTCATTAATTGGTGCTTCATCGCCCTTGCCTGCTTTTTATAATGATTATTT
ACTGCAGGATGAAAACAACGTTCTAAAGTCATTTCTTGATATTTTCCATCACAGATTACATCGTTTAATT
CGTAGTGTTTGGCAAAAGTACCGTTATAACGCAGCGTTTAGAGAAGGCGCCAATGATCCGTTTTCACAAT
ATATATTCGCATTGCTTGGATTAAAAAATCCTGAACTGCGTGATGACGACTCAATCAACTGGTCTCGCTT
ATTTCCTTACCTTGGTTTGCTAAGTCAAAGGGTCAGATCAGCAAATACAATAGAAGCGCTATTACGATAC
TACTTCCAGCATTCAGCGATACATATTGAAGAGTGCATTCTTCGTCACTGTTCAATTCCAACACAACAAC
TCTGTGAATTGGGCCAGAACAATGCCGTTCTTTCTAGCAGCTCTGTTTTGGGCAGTAGTGCACCAGATAG
AGCAAATAAATTTCGTATACATATAAAAGAATTAACGTGGGATCACTTCCACTCTTTTTTAACCGATAAA
CCAAATTGGATCGCACTCAATCAATTAGTGCAATTTACCGTTAAAGATCCACTCGATTTTGATATTCAAC
TTCATTTAAAAAAAGATGAACCCCGTCCATTAACCTTATCAGTTGATAATGAATGCTGTTTAGGTTGGAC
GAGTTGGCTAGGTTCAAACCCAAATGAAGGACGTATTACACTTTCAGGGAAAACATTATGA