SecReT6
Protein ID: 59711609
SecReT6 ID84
T6SS typei1
Gene symbol-
Locus tagVF_1002
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1107182..1107607 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ5E649
KEGG IDvfi:VF_1002
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.90E-18, Aligned region: 21..113
Protein Sequence: 141 a.a.     [Download]
>gi|59711609|ref|YP_204385.1| hypothetical protein VF_1002 [Vibrio fischeri ES114]
MSNQRLFERLLSGTTQSNQSVTAQHMTDSIRSHVSQLLSTRQGAALICPDLGLPDLNMSHMSPHDAILHI
KREVERVIARYETRIINPQVRYLGDIYNPLRLYFDVSGDVIINGQNTAISFTAHAQAANRKAETNITQGA
A
 
Nucleotide Sequence: 426 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1107607-1107182 Vibrio fischeri ES114 chromosome I, complete sequence
ATGTCGAACCAACGATTATTTGAACGACTATTAAGTGGTACAACACAAAGCAATCAATCTGTCACAGCAC
AGCATATGACGGACTCAATTCGCTCACACGTCAGTCAGTTACTTTCAACAAGACAAGGGGCTGCATTGAT
CTGTCCTGATTTAGGCTTACCAGATCTTAATATGTCTCACATGAGTCCACATGATGCCATCCTTCATATT
AAACGCGAGGTTGAACGTGTTATCGCTCGCTATGAAACGAGAATCATTAATCCTCAAGTCCGCTATTTAG
GTGATATCTATAACCCATTACGTCTCTATTTTGATGTCAGTGGTGATGTCATCATCAATGGGCAAAATAC
CGCTATTTCATTTACCGCTCATGCTCAGGCAGCTAACCGTAAAGCTGAAACCAATATTACACAAGGTGCA
GCATGA