SecReT6
Protein ID: 59711610
SecReT6 ID84
T6SS typei1
Gene symbol-
Locus tagVF_1003
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1107697..1109172 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ5E648
KEGG IDvfi:VF_1003
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-193, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|59711610|ref|YP_204386.1| hypothetical protein VF_1003 [Vibrio fischeri ES114]
MSDTSTAQELDNQVTVGLLDQIVAQTNLTPEDETYGIAKRGVSAFIEELLKPQNQEEPVKKALIDKMITE
IDQRLSKQVDEILHHSSFQQLESAWRGLKLLVDRTDFRENIKIEVINVSKTDLLEDFEDASEITQSGLYK
HVYTNEFGTFGGQPVGAIIGNYDFGPSAPDIKNLQNLASVAAMSHAPFISAAGPKFFGLESFEGLPDLKD
LNDHFESPQYAKWQSFREQEDSRYVGLTLPRFLLRQPYDPEENPVKAFNYHENVSATHEDYLWGNTAFTM
ATRITESFANFRWCPNIIGPQSGGAVEDLPLHHFESMGDIETKIPTEVLVSDRREYELAEEGFIALTMRK
GSDNAAFFSANSVQKAKFFGNTEEGKNAELNFRLGTQLPYLFIISRLAHYIKVLQREQIGSWKERTDLEQ
ELNTWIRQYIADQENPPAEVRSRRPLRAANIEVMDVEGNPGWYKVNLSVRPHFKYMGSDFTLSLVGKLDQ
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1109172-1107697 Vibrio fischeri ES114 chromosome I, complete sequence
ATGTCAGATACAAGCACAGCACAAGAGCTAGATAATCAAGTTACTGTTGGACTTCTTGATCAAATCGTAG
CTCAAACCAATTTAACTCCAGAAGATGAAACATACGGTATTGCTAAGCGTGGTGTCAGCGCTTTTATTGA
AGAGTTATTAAAACCTCAGAATCAAGAAGAGCCAGTCAAAAAAGCTTTAATTGATAAAATGATCACAGAG
ATTGATCAACGCTTAAGTAAACAAGTGGACGAAATTCTTCACCACTCGTCTTTTCAACAACTTGAATCTG
CTTGGCGTGGATTAAAATTACTCGTTGACCGCACCGATTTTCGTGAAAATATTAAAATCGAAGTGATTAA
TGTATCTAAAACTGACTTGTTAGAGGACTTCGAAGATGCTTCAGAAATTACTCAATCAGGACTCTACAAG
CATGTCTACACTAACGAGTTTGGTACATTTGGTGGCCAACCTGTTGGTGCTATTATTGGTAATTATGACT
TTGGTCCTTCTGCGCCTGATATTAAAAACCTTCAAAACTTGGCTTCTGTAGCAGCAATGTCTCATGCACC
ATTTATTTCAGCCGCAGGCCCTAAATTCTTTGGCTTAGAATCATTTGAGGGATTACCTGATCTAAAAGAT
CTTAATGATCATTTTGAAAGTCCTCAATATGCAAAATGGCAAAGCTTCCGTGAACAAGAAGACTCAAGAT
ATGTAGGTTTAACATTACCTAGATTCTTATTACGTCAACCTTATGATCCAGAAGAAAACCCTGTAAAAGC
ATTCAATTACCATGAAAATGTTTCTGCTACTCACGAAGATTATTTATGGGGAAATACCGCTTTTACAATG
GCAACTCGTATCACTGAAAGTTTTGCTAATTTCCGTTGGTGTCCAAATATTATTGGTCCTCAATCAGGTG
GTGCAGTGGAAGACCTACCTCTCCACCACTTTGAAAGTATGGGTGATATTGAAACTAAGATCCCAACAGA
AGTTCTTGTTTCCGACCGCAGAGAATATGAATTAGCAGAAGAAGGCTTTATTGCTCTCACCATGCGCAAA
GGCTCAGATAATGCGGCTTTCTTCTCTGCTAACTCTGTTCAAAAAGCAAAGTTTTTCGGTAATACAGAAG
AAGGCAAAAACGCTGAGTTAAATTTCCGTTTGGGTACGCAGCTCCCTTACTTGTTCATTATTAGCCGCCT
TGCACATTACATTAAGGTGCTACAACGTGAACAAATCGGTAGTTGGAAAGAACGTACAGACTTAGAGCAA
GAGTTAAACACTTGGATTCGTCAATACATTGCTGATCAAGAAAATCCACCAGCTGAAGTTCGTAGCCGTC
GTCCACTTCGTGCAGCAAATATCGAAGTAATGGACGTTGAAGGAAATCCAGGCTGGTACAAAGTAAACCT
ATCAGTTCGCCCACACTTCAAATACATGGGTTCTGATTTTACGTTGTCGCTAGTTGGTAAATTGGATCAA
GAGTAA