SecReT6
Protein ID: 59711611
SecReT6 ID84
T6SS typei1
Gene symbol-
Locus tagVF_1004
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1109176..1109676 [-]
Productcytoplasmic protein
NoteTssB
UniProt IDQ5E647
KEGG IDvfi:VF_1004
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.10E-54, Aligned region: 5..160
Protein Sequence: 166 a.a.     [Download]
>gi|59711611|ref|YP_204387.1| cytoplasmic protein [Vibrio fischeri ES114]
MSKDGSVAPKERVNVTFKPVSGDAAEDLELPLKMMVLGDFTQQEDDRKLEDRKPFNVDKSNFNDVIEKQN
LNISFGVKNQLQDDGEGNEEIAVDLSFKHINDFDPSSIVEQVPELKGLMDLREALVSLKGPLGNVPAFRK
AIEDALVDDEAREKLLSELGLVTEKE
 
Nucleotide Sequence: 501 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1109676-1109176 Vibrio fischeri ES114 chromosome I, complete sequence
ATGTCAAAAGATGGATCTGTTGCACCAAAAGAACGTGTAAATGTGACATTCAAACCAGTAAGCGGTGACG
CTGCAGAAGATCTTGAACTTCCACTGAAAATGATGGTTCTTGGTGACTTTACTCAGCAAGAAGATGATCG
AAAACTTGAAGATCGAAAACCATTTAATGTTGATAAAAGCAATTTCAATGACGTTATTGAAAAACAAAAC
TTAAACATCTCTTTTGGTGTAAAAAACCAACTTCAAGATGATGGCGAAGGAAATGAGGAAATTGCAGTCG
ATCTAAGTTTTAAACATATCAATGATTTTGATCCTTCAAGCATTGTTGAGCAAGTGCCTGAACTAAAAGG
CTTAATGGATTTACGTGAAGCGCTTGTCTCTTTAAAAGGCCCATTAGGCAATGTTCCTGCATTCCGCAAA
GCAATTGAAGATGCCCTTGTTGATGATGAAGCTCGTGAAAAACTACTAAGTGAATTAGGTTTAGTGACAG
AAAAGGAATAA