SecReT6
Protein ID: 597513597
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0927
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]950009..950410 [-]
Product-
NoteTssE
UniProt IDW9B470
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.00E-16, Aligned region: 17..106
Protein Sequence: 133 a.a.     [Download]
>gi|597513597|ref|CDO12688.1| - [Klebsiella pneumoniae]
MLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSMIHQGMTAGIHGLIHQIE
ETLLRYEPRLSQLRVELQPQPRPGHLNYLIYAQLPDTGWIRFDGIFSAEGRIVLRHLKQQERA
 
Nucleotide Sequence: 402 bp     [Download]
>gi|597513597|emb|FO834906.1|:c950410-950009
atgctgactttcagcttcagtggcgagctgccgctggagcaggtcagcgagcgggatcagcttattctct
ccgttatggacaacatgcagcgcatcatcaactgccgggcaggaacgctggcgcatttaccggattatgg
tttgccggacctcagcatgattcatcagggaatgaccgcgggtattcatggtttgatacaccagatagaa
gagacgttactgcgctacgaaccccgcctgagccagttgcgcgtggagttgcagccgcagccacgtccgg
ggcatctcaattatcttatttatgcccaacttcccgataccggctggatacgctttgatggtatattttc
tgcggaaggccggattgtgctgcgtcatcttaaacagcaggagcgcgcgtga