SecReT6
Protein ID: 597513598
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0928
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]950438..950698 [-]
Product-
NoteTssJ
UniProt IDW9B3E4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-15, Aligned region: 2..76
Protein Sequence: 86 a.a.     [Download]
>gi|597513598|ref|CDO12689.1| - [Klebsiella pneumoniae]
MQEEKTLKSDVLAKHTVWMKPAGAVSLNVPLDKETQFIAIVGQFYHPDEQSNSWRLVLKRDELEADRPRT
IELMRSDLRLLPLQDK
 
Nucleotide Sequence: 261 bp     [Download]
>gi|597513598|emb|FO834906.1|:c950698-950438
atgcaggaagaaaaaacgctgaaatcagatgtactggccaaacataccgtctggatgaagccagcgggtg
cggtttccctgaatgtccctctggataaagagacccagtttatcgccatcgttggtcagttttatcaccc
cgatgaacaaagcaacagttggcgattggtactcaaaagggatgaactggaagctgacaggccccgcacc
atagagctgatgagaagcgatctccgcctgctcccccttcaggataagtaa

Protein ID: 597513602
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0932
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]952051..952311 [-]
Product-
NoteTssJ
UniProt IDW9B473
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-12, Aligned region: 18..85
Protein Sequence: 86 a.a.     [Download]
>gi|597513602|ref|CDO12693.1| - [Klebsiella pneumoniae]
MFLTPYKRHAISVLAAVTLLSGCGLTQRVTDGTKEVASAIFYKQIKTLHLDFVSRSALNTDAQDTPLSTM
IHVWQLKTRERFDEAN
 
Nucleotide Sequence: 261 bp     [Download]
>gi|597513602|emb|FO834906.1|:c952311-952051
atgtttcttacaccctataaacgacatgcaatcagcgtacttgccgccgtgacgctgctgagcggctgcg
gtctgactcagagagtgactgacggcactaaagaagtggcatcggcgattttctacaagcagatcaaaac
gctgcatctcgattttgtatcgcgcagcgcgctgaatacagatgcgcaagacacaccgctttccacgatg
atccatgtctggcaactgaaaacacgtgagcgttttgacgaggccaactag