SecReT6
Protein ID: 597513603
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0933
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]952292..953374 [-]
Product-
NoteTssG
UniProt IDW9B3E9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-83, Aligned region: 19..320
Protein Sequence: 360 a.a.     [Download]
>gi|597513603|ref|CDO12694.1| - [Klebsiella pneumoniae]
MDRTPQPARTGLTERLAPDINRINFYRFCQLLEQSQPQTPLLGSTTNPADDPVRFRPHPGMGFPVSELKS
VEQDLDHPDAPPTVRTTFLGLYGVDSPLPTAYLDYIAQRRDGHEAMMAFLDIFNHRFITQYYRIWRKYNY
LTSFEPGAVDNISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGITALVRLLAPQTQATV
IPHDPQQIVLPEPAGLSKRSRICLKTRALLGNTGTDVNSQLLMKLYTEDDGEARGWLPGGQLHTDLLVLL
RVYLGWRYQARLQLTLPVSLLPPAQLGNQRVQVSRTGVLRASFAAPVAGTVTVSLGRYQGLMPTSSTRDR
ESVTHVSYTL
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|597513603|emb|FO834906.1|:c953374-952292
atggacagaacaccacagccagcgcgtaccgggctgacggaaaggcttgctccggacattaaccgaatta
acttttaccgtttctgccagcttcttgaacaaagccaaccacagacgccactgctggggagcacaaccaa
tccggcagacgatcctgtccgttttcgtccacatccggggatggggttcccggtaagcgaactaaaaagc
gtcgaacaggatttggatcatcctgacgcgccacccacggtgcgcaccacgtttctggggctgtacggtg
tggattcaccgctgccgacagcctatctcgactacatcgcgcagcgccgggacggccatgaagcgatgat
ggcgtttctggacatttttaaccatcgctttatcactcagtactatcgtatctggcgcaaatataattac
cttacgtcgtttgaaccgggagccgtggataatatttcccgctgcctgctggggttgattggtctgggca
ttcccggcagcgaaaatcatatcgccacgccggtctcgcgttttctggcattactcagcgtgatgcgtct
gccgacgcgtacagcagaaggcataacggcgctggtcagattactggccccccagacgcaagcgacagtt
atcccgcacgatccacaacaaattgtcctgcctgaacctgcgggtttatcaaaaagatcacgtatttgcc
tgaaaactcgggcactgctgggcaacaccggcactgacgttaacagccagttactgatgaagctgtatac
cgaagacgacggagaggcacgcggctggctgccgggcgggcaactacataccgacctgctggtgctgttg
cgtgtctatctgggctggcgctaccaggcccgcctgcaactgaccttgcccgtcagtctgctgcctccgg
cacagttaggaaatcagcgcgttcaggtaagccgaacgggcgtgctgcgggcgtcttttgctgccccagt
cgccggtacggtcacggtcagtctcgggcgttatcagggactcatgcccacatcatccacccgcgacagg
gagagtgttactcatgtttcttacaccctataa