SecReT6
Protein ID: 597513604
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0934
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]953338..955098 [-]
Product-
NoteTssF
UniProt IDW9BN82
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-179, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|597513604|ref|CDO12695.1| - [Klebsiella pneumoniae]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELLTDHRQMKQSETLSDFQVLSRPVGEHRTRCCYSATRDITLLPLAL
PEVSLLYEQDGRSVIRLRFECSPLAGDGSQIDLSRLPLYLNADSPLACALHRALTLGVQQIWFRLPGEER
RTLDGYFSPMGFGKDDPLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLENVVWPAGMSGFEIDVVLAE
SWSHDLPFSTENIRLHCVPVINLFPLEADPLHLSPLENEYLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDSPERYYHTRVKRGPSGLHDTWLILGGDAFDIDRLLEDETLSLSLTGTNGQLPR
KALQSTVLDPPVYATQHTLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHHLIQRFEKGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|597513604|emb|FO834906.1|:c955098-953338
atggacgacctgacccaacgctattacgaagccgaaatgcgctacctgcgtgaagcgggtaaagagtttg
cacaagcgtatcctgatcgcgccgctatgctcaatctcgataagcccggcgcgcgcgacccttatgtcga
acgtctcttcgaaggtttcgccttcctgatgggccgcctgcgggaaaaactggatgacgatctacctgaa
ctgactgaggggctggtgagcctcctgtggcctcattatctgcgtacaatcccgtcgctgtcggtggtgg
aactgttaaccgatcatcggcaaatgaagcagagcgaaacactgagtgattttcaggtgctctcgaggcc
cgtcggcgaacaccggacacgttgctgctacagcgccacgcgggatatcaccctgcttccgctggcttta
ccagaggtgtcgttactgtacgaacaggatggacgctcggttatccgtctgcgctttgagtgcagcccgc
tggctggcgacgggtcacagattgatttatcgagactgccgctctatctcaatgcggacagtccgctggc
ttgtgcattacaccgggcgctgacgctgggggtgcagcaaatctggtttcgcctgccgggggaggaacgt
cggacactggacggctatttttccccgatggggttcggtaaggacgatccgctctggccaaaaggcgaat
cggccttcagcggctaccaactgctgctggagtatttcaccttccgcgagaagtttatgtttgtcgccct
caacgggctggagaatgtggtctggccggcaggaatgagtggattcgaaattgacgtggtgctcgcggaa
agctggtctcacgatctgccgttcagcaccgaaaatatccgcctgcactgcgtaccggtgatcaacctgt
tcccgctggaagccgatccactgcatctttctccgctggaaaatgaatacttgctgcgccccatgcgtat
tcaggacgggcatacggaaatttactccgtcgataatattatttcttcgcgacacaccggcagtcaggca
tatgtgcccttttccagttttcgccaccggggcgggatgttgcgtcacgattcgccggaacgttattacc
atacgcgggtaaaacgcggcccttccggtttgcatgatacctggctgatccttgggggcgacgcattcga
tatcgaccgcctgctggaagacgaaaccctgtccctgagcctgaccggcaccaacggtcagcttccgcgt
aaagcgctgcagagcacggtgctggacccccccgtctacgccacgcagcatacactgcgggtgcgcaacc
tgtgcgcgccgacgcagccctgttatcccccggcgcgtgaccgtttccactggcgggttctcagccactt
aggctccaacttcctgtcaatgatggacaacgccgaaatcttgcgcggcacgctggcgctgtacgactgg
acggaaagcgaaatgaaccgacgccgtctggaggcaatcgttgacgttcagcatcacctgattcagcgtt
ttgaaaaaggttttctactgcgcggcgtggatattcaggtcacgctggacagcaacggtttcgccggcga
aggcgatatcaccctgtttggcgaactgctgcaccgctttttcgccctgtatgccgacatccacttattt
actcagttgacgctgattctgcaacctacaggaaaatgtttgcaatggacagaacaccacagccagcgcg
taccgggctga