SecReT6
Protein ID: 597513614
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0944
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]965716..968271 [-]
Product-
NoteTssI
UniProt IDW9BN84
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-60, Aligned region: 31..347
Phage_GPD [PF05954], Evalue: 1.30E-60, Aligned region: 766..799
DUF2345 [PF10106], Evalue: 9.80E-45, Aligned region: 597..751
T6SS_Vgr [PF13296], Evalue: 8.40E-38, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 2.60E-14, Aligned region: 392..473
CbiD [PF01888], Evalue: 0.0095, Aligned region: 554..669
Protein Sequence: 851 a.a.     [Download]
>gi|597513614|ref|CDO12705.1| - [Klebsiella pneumoniae]
MDVQNFDHSHHALKIRGLSSGVDVLSFEGKEQLSAPFRYDIQFTSSDKFIAPESVLMQDGAFSLTAPPVQ
GIPTQTPLRTLYGVITGFKQLSSSRDEARYEVRLEPRLALLSRSHQNAIYQNQTVPQIVEKILRERHEMR
GQDFVFNLKSDYPSREQVMQYDEDDLTFISRLLSEVGIWFRFSTDARLKIGVIEFYDDQSGYERGLTLPL
RHPSGMSDSGTEAVWGLNTAYSVVSRSVTTRDYNYREAMAEMTTGQFDVTGGDNTTYGEAYHYADNFLKT
GDKATPESGAFYARIRHERYLNGRAILKGQSTSSLLMPGLEIKVEGNDAPEVFRKGILITGITASAARDR
SYELTFTAIPYSERYGYRPPLIRRPVMAGTLPARVTSTTANDVYAHIDKDGRYRVNLDFDRDTWKPGFES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEDGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAIRAKKGVFISADAQEKAQGQ
VLDMQAAITQLENALSIAKSLSQAAEVAKAHGADLDGHTSLNGALSELVKAGIVLSAPEGVGIVSPQGVR
LGSGESSIGLMAGTNIDAGAMEKVTVSAGDAVSVFARKGGIKLYANQGKVEVEAQNERMRLTSRHGMKIS
STEDVVEIEAEKELVLKCGKAYIRLSGGGVEVGGPKNILLKSANVQKMSKAQLPVEMPVLPGKGNYDLSL
DLRDWDGIPIGGAKYTIAFESGAVLSGMLDDKGYALHTNVLPESATVEYEFPEPEPDKPWDPYSSLLASV
DAELGADGQGA
 
Nucleotide Sequence: 2556 bp     [Download]
>gi|597513614|emb|FO834906.1|:c968271-965716
atggatgtacagaacttcgaccactcacaccacgcgttaaaaatccgcggcctgagcagcggcgtggacg
tactgtcctttgaaggcaaggagcaattaagcgccccgttccgctatgacattcagtttaccagcagcga
taagtttattgcgccggagtcggtactgatgcaggacggggcattcagcctgaccgccccgccggtgcaa
gggataccgacgcagactcccctgcgtaccttgtacggggtgatcaccggatttaagcaattgtcttcct
cacgggacgaggcgcggtatgaggtgcggctggagccccgtctggcgctactgtcccgcagtcatcagaa
cgcgatttatcagaaccagacggtgccgcaaatcgtggagaaaatactccgcgagcggcatgagatgcgc
ggtcaggactttgtgtttaacctgaaaagcgactacccgtcacgcgagcaggtcatgcagtacgacgaag
acgatctgacattcatctcacggctgctgtcggaggtgggtatctggttccggttcagtaccgacgcccg
actgaaaatcggggttatcgagttttacgacgaccagagtggctatgagcgcggcctgacgctgccgctg
cgtcacccttcggggatgagcgacagcggaaccgaagcagtgtggggtctgaacacggcctacagcgtgg
tatcgaggtccgtcacgacgcgggattacaactaccgtgaagcgatggcggagatgacaacaggccagtt
tgacgtaacaggcggggataacaccacctacggtgaagcctatcattacgctgacaattttctgaaaacg
ggtgacaaagcgacgccggagagtggtgcattctatgcgcgtatccgccacgaacgctacctgaacggac
gcgccatcctgaagggacagagcaccagttctctgctgatgccggggctggagataaaggtcgagggtaa
tgatgcgccagaggtattccgcaagggcattctgataaccgggattaccgccagcgcagcacgagaccgc
agctacgaactgacattcaccgccatcccctattccgaacgctacggctaccgccctcctctcattcgca
ggcctgtgatggcagggacactcccggcgcgggtgaccagcaccacggcaaatgatgtctacgctcatat
cgacaaagacgggcgctatcgagtgaacctggactttgaccgggatacgtggaagccgggtttcgagagc
ctgtgggtacggcagtcacgcccctatgcgggagatacttacggtctgcacctgccgctgctggcgggaa
ccgaggttagcatcgcgtttgaggatggcaacccggacaggccatatatcgccggggtgaaacacgactc
ggcgcacaccgaccatgtgaccatccagaactataagcgcaacgtgctgcgcaccccggcgaataacaaa
atccggctggacgatgagcggggtaaggagcacatcaaggttagcacagagtacggcggaaagagccagc
tgaacctgggacatctggtggatgctgggaagcagcagcgcggtgagggtttcgaactgcgcaccgatat
gtggggtgcgataagagcgaaaaaaggtgtctttatcagcgccgatgcgcaggaaaaggcgcaggggcag
gtactggatatgcaggcagcaataacgcaactggaaaatgcgttatcgatagcaaaaagtctgtcacagg
cggcggaggtggcgaaggcgcatggtgcggatcttgatgggcatacgtcgctgaacggcgcgctgtcgga
gcttgtaaaggcagggatagtgctgagcgcgccggaaggcgtggggattgtaagtccacagggcgtcaga
ctgggttcgggagagagcagtatagggctgatggcgggaacaaatattgatgcaggggcgatggagaagg
tgactgtctcggcgggagacgcggtgagtgtatttgcgcgcaagggagggataaagctgtacgcaaacca
gggaaaagttgaagtggaggctcagaacgagagaatgcggctgacatcgcgccatgggatgaagataagc
agtacggaagatgtggtggagatagaggcagagaaggaacttgtgctgaaatgcggcaaggcgtacatca
ggctgagcggcggcggggtggaggtaggaggaccgaagaatatcctgttgaaatcagcgaatgtgcagaa
gatgagtaaagcgcagttgccggttgagatgcctgtgctgccgggaaaaggtaattacgatctgtcgctg
gatctgcgggactgggatggtattcccattggtggcgcgaagtacacaatcgcttttgagtcaggggctg
tattgtcgggcatgttagatgataaagggtacgcactgcataccaatgtcctccccgaatcagcaacggt
ggaatacgaatttccagagccggaaccggacaaaccttgggatccctattcgtccctgcttgcctcagta
gatgctgaattaggggcggatggacagggagcataa