SecReT6
Protein ID: 597513615
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0945
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]968487..970190 [-]
Product-
NoteTagL
UniProt IDW9BDK0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 9.2e-17, Aligned region: 434..530
Protein Sequence: 567 a.a.     [Download]
>gi|597513615|ref|CDO12706.1| - [Klebsiella pneumoniae]
MSRVSNTLKQALLLWSMLLVLALWLGFNQASTAMKFGVTVALIIIAVGLLACWRGKKRQTEADSAWLSRL
PPKTYRQPVVLVCGDAAASLFTENPLRQVAGGLYLHVADEEQLIRQAEVLLADRPAWASQLCVACTVVPV
VHLDMAVLAGRLRRFVGGLATVRRRAGIKVPLLLWSWLPGTGREDDLPWFICAGGKVQVVTPAGESSPTA
WAAQPGTDGSSLRLCHLLRMESLMQWLNQMVLPELNGYPPLAAGMGQAPSLPALEGNLWQTWTTAKTGLT
PEAIPKIGASPLPFPDMMLPLLPRQSGFTPVRRACVAALLMTTVAGVAALCLSATANRSLLLQVSDDLHK
YDAVPADNDAAKAHHLSVLKDDANILDSYFREGEPLRLSLGLYPGERLRQPVWRVIRDYRPPEKKRDVAD
ALPVQSVRLDSMALFDVGQARLKDGSTKVLINALVNIRARPGWLIVVTGYTDTTGNKKANQQLSLRRAEA
VRDWMLQTSDIPATCFAVQGLGESHPAATNDTPEGRAANRRVEISLVPRTDACQDVKQNMLPEPALSQLN
PQGVSAI
 
Nucleotide Sequence: 1704 bp     [Download]
>gi|597513615|emb|FO834906.1|:c970190-968487
atgagccgggtgagtaacacgctgaaacaggcgcttttgctgtggagcatgctgctggtgctggcgctat
ggctgggattcaatcaggcctctacggcgatgaaatttggcgtgacagtggcgcttatcatcatcgcagt
aggcctgctggcgtgctggcgcggaaaaaaaagacagactgaggccgacagcgcatggctgtcccgattg
ccgcccaaaacatatcggcagcccgtagtgctggtgtgcggcgacgcggcagcatcgttattcacagaaa
acccgctgcggcaggtcgcgggagggctgtacctgcacgttgcggatgaagagcaacttatcagacaggc
tgaagtgctgctagctgaccgccccgcatgggcttctcagttatgtgtggcctgcacggtcgtgccggtt
gttcatctggatatggctgttctggcgggacgattgcgacgctttgtcggcggtctggcgacagtgcgcc
gcagggcgggcataaaagtgccgctgctgctgtggagctggctgcccggcacagggcgagaggatgatct
accgtggtttatctgcgccggcggcaaggttcaggtggtgacacccgccggagaaagctctccgacggca
tgggcggcacagcccggaaccgatgggagcagcctgcggctttgccatcttctgcggatggaaagcctga
tgcagtggctcaatcagatggtgttaccagagctgaacgggtatccgccgctggcggcgggcatggggca
ggcgccatcgctgcctgcgctggaaggcaatctgtggcagacatggacaacggcaaaaacgggactgacg
ccggaggcgataccgaagatcggcgcatctcccctgccgttcccggacatgatgctgccgctgttaccac
gtcaatcaggatttacgccagtgcgccgcgcctgcgtggcggcgctgctgatgaccaccgtggcaggagt
ggctgcgctctgtctgtcagcaaccgcaaaccgcagcctgctgctgcaggtgagcgacgatctacataaa
tatgatgccgttccggcagacaacgacgccgctaaagcccaccacctgtcggtcctgaaggacgatgcaa
atattctggatagctattttcgcgaaggggagccattacgtctcagtctgggcttatatcccggcgaacg
gctacgccagccggtatggcgggttattcgcgattaccgtccacctgagaaaaaaagggatgtagcagac
gcattaccggtacagagcgtgcgtctcgacagcatggcgttgtttgacgtcggacaggcccgtctgaaag
acggctcgacaaaagtgctgattaacgcgctggtaaatatcagggcaaggccgggctggctgattgtggt
caccggatataccgataccaccggcaataaaaaagccaatcagcaattgtcgctgcgacgcgcggaagcc
gtgcgcgactggatgctacagaccagcgacattccggccacctgttttgccgtacaggggctgggcgaaa
gccatcctgcggcaactaacgatacgccggaaggcagggccgctaaccggcgcgtcgaaatcagtctggt
tccccgcactgacgcctgtcaggacgtgaaacagaacatgctgccagaaccggcgttatctcagttaaat
ccacaaggagtttcagccatctaa