SecReT6
Protein ID: 597513616
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0946
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]970193..970858 [-]
Product-
NoteTssL
UniProt IDW9BCQ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.80E-47, Aligned region: 12..208
Protein Sequence: 221 a.a.     [Download]
>gi|597513616|ref|CDO12707.1| - [Klebsiella pneumoniae]
MTQERKIDIDVLLRDTFLTVVELRQGTSARHGQELYRHCLQQVEGVRERLTAAGFSQQDIEHITYAQCAL
LDETVLSRDVMDDGQMVWLKNPLQSHFFNTLQAGELLYERMKRFLQEPAPTPAVLTCFHRVLLLGFRGRY
QDPESDERQHLIAMFSKRVEPFRVQEDSAVLNVPLTRRQHYLWQSPFCWLLLLMLVLVGVWWGLHSWLNV
LVDELLPTGKS
 
Nucleotide Sequence: 666 bp     [Download]
>gi|597513616|emb|FO834906.1|:c970858-970193
atgacacaggaacggaaaatcgacattgacgtactacttcgcgacacctttctgacggtggtggaactgc
gtcagggcacttctgcaagacacggacaggaactatatcgccattgtctgcagcaggtggaaggggtacg
cgagcgtctgacagcggccggattcagccagcaggacatagaacatatcacttacgctcagtgcgcgctg
ctggacgaaaccgttctcagccgggacgtgatggatgatggccagatggtctggctaaaaaaccctctcc
agtcgcattttttcaatacccttcaggcgggcgaactactgtatgagcgtatgaagcggtttttacagga
gccagcccccacgccggcggtcctgacctgttttcatcgcgtgctgttgctggggtttcgcgggcgctat
caggaccccgaatctgatgaacggcagcatctcattgcgatgttcagcaagcgggttgagccattcaggg
tgcaagaagattcggcagtgctgaacgtgcctttgaccaggcgtcagcattacctgtggcagtctccttt
ttgctggctgctactgctaatgcttgtgctggttggcgtctggtgggggttgcatagctggctgaatgta
ctggtggatgaactgctgccaacaggcaagtcttga