SecReT6
Protein ID: 597513617
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0947
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]970855..972195 [-]
Product-
NoteTssK
UniProt IDR4YD55
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.60E-132, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|597513617|ref|CDO12708.1| - [Klebsiella pneumoniae]
MKIHRPLWAEGTFLSSQQFQQQARWETYSNNSIAQLGIRHPWGVARVEFDREALALGKLKLRTLRLRFSD
GSLIDSEVSDALPLACDLHTLAVENTAIVVLALPLEHANGGNLGQEKHTERPLRYRQEWHKVQDIYGSDS
EEMAVECHALSLRFAHDNNQDYITCPLARLTRNGQGNWSQDESYIPPLLALSAHIGLVERLDTLLLQLQA
KCRRLMALRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPSIHPELVWRELARLAGALLTFSL
EHNVSAIPAYVHDAPASVFPPLFTLLSELLEASLPSRVIALELESLPGNRWKAELHDPRLREEADFYLSV
RSSLPTHVVLQQLPRLCKIGAPDDVTLLVNVALNGVPVVPLTQVPAALPLRLENQYFALDMQSAPAKAML
DAGCCMIYAPGTLGDLKPELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|597513617|emb|FO834906.1|:c972195-970855
atgaaaattcatcgaccactatgggctgagggaacgttcctgtcctcacaacagtttcagcagcaggccc
gctgggaaacgtacagtaacaacagcattgcacagctgggtatccgtcatccatggggtgtggcgagagt
cgagtttgacagagaagcgctggcgttagggaagttaaaattacgtaccctgcgcctgcgtttttccgat
ggctcgttgatcgactccgaagtttccgatgcgctgcctctggcttgtgatttacatactctggcggtgg
aaaatacggcaatagttgtcctggcgttaccgctggaacatgcgaatggcggtaatctgggacaggaaaa
gcatactgaaagacccctgcgttatcgtcaggaatggcataaagtacaggatatttatggcagcgacagt
gaagaaatggccgttgaatgccatgcgctgtcattgcgtttcgcccatgataacaatcaggattacatca
cctgcccgcttgcacgtctgacgcggaatggtcagggtaactggtctcaggatgaaagctacatcccgcc
gctgcttgccctcagcgcacatattggtctggtggagcgactggatacgttgctgttgcagctacaagcg
aagtgccggcgtctgatggccctgcgccgggaaagcaatcagcgtatggcggacttcgcggtagcggatg
tgtccctgttctggttactcaatgcgttgaacagcgctgaaccggttctaagtgattttttacggtatcc
gagcatccatcctgaactcgtctggcgcgaactggctcgtctggccggcgcgttgctgaccttttccctt
gaacacaacgtgagcgccattcccgcatatgtccatgatgctccagcctccgtttttccgccgcttttta
ccctgctcagcgaactgctcgaagccagcctgccgtcgcgggtgattgcgctcgagctggaatcccttcc
cggcaaccgctggaaagccgaacttcacgatccacgcctgcgggaagaggcggatttttacctttctgtt
cgctcctcgctgccgacgcacgtcgttctgcaacagttaccacggctctgcaaaatcggggcgccggatg
acgttacgttgttggttaatgttgcgctgaacggtgtccctgttgttccgctgacgcaggttccggctgc
attgccattacggctggagaatcagtactttgcgctggatatgcagagcgctccggctaaagccatgctg
gatgccgggtgctgcatgatttacgcgccgggtacgctgggcgatctgaaacccgagctttttgcggttc
tgcggtcatga