SecReT6
Protein ID: 597515126
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2462
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2564540..2565031 [+]
Product-
NoteTssB
UniProt IDW9BFU8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.50E-53, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|597515126|ref|CDO14218.1| - [Klebsiella pneumoniae]
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEF
SPEVNLSVPNTLAGNGKEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|597515126|emb|FO834906.1|:2564540-2565031
atggctgatacgttccagaatgaagtccccagagcgcgcattaatctcaaattatctcttcataccggcg
gcgcgcaaaagaaggtcgaactgccgctcaaactgcttaccattggcgattttagtcatggtaaggaaaa
ccggcctttatcggaaagagaaaaaatcaacgtcaataaaaataattttaacagcgtactttcggaattt
agcccggaagttaacctctcggtgccgaatacgctggccggcaatggcaaagaggagaacgtcagactgc
gttttaccgacatcaaagattttgaaccggagcaggttgcccggcaaattccgcaactccgcgccatgct
ggcgatgcgtaatttattacgcgatctcaaatccaatctgctcgataacgccactttcagaaaagagctt
gaggcaatcctgaaagatccggcgctgtcccaggaattacgcgacgaaatgagtgcgcttgccccgaaat
aa